MLF1 (myeloid leukemia factor 1)

Gene

• Entrez ID: 4291
• Gene name: Myeloid leukemia factor 1
• Gene symbol: MLF1
• Synonyms: -
• Chromosome: 3
• Chromosome location: 3q25.32
• Summary: This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multipl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043951	hsa-miR-378a-3p	CLASH	23622248
MIRT042653	hsa-miR-422a	CLASH	23622248
MIRT1150959	hsa-miR-4698	CLIP-seq
MIRT1150960	hsa-miR-802	CLIP-seq
MIRT1150961	hsa-miR-105	CLIP-seq
MIRT1150962	hsa-miR-1323	CLIP-seq
MIRT1150963	hsa-miR-548o	CLIP-seq
MIRT2043054	hsa-miR-23a	CLIP-seq
MIRT2043055	hsa-miR-23b	CLIP-seq
MIRT2043056	hsa-miR-23c	CLIP-seq
MIRT2043057	hsa-miR-3647-3p	CLIP-seq
MIRT2043058	hsa-miR-3680	CLIP-seq
MIRT2043059	hsa-miR-4282	CLIP-seq
MIRT1150959	hsa-miR-4698	CLIP-seq
MIRT2043060	hsa-miR-4798-3p	CLIP-seq
MIRT2043061	hsa-miR-653	CLIP-seq
MIRT2272538	hsa-miR-543	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002318	Process	Myeloid progenitor cell differentiation	ISS
GO:0003677	Function	DNA binding	ISS
GO:0005515	Function	Protein binding	IPI	12176995, 15861129, 16189514, 20374249, 22151054, 23414517, 25036637, 26871637, 28514442, 31515488
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005929	Component	Cilium	ISS
GO:0006351	Process	Transcription, DNA-templated	ISS
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IDA	15861129
GO:0019904	Function	Protein domain specific binding	IDA	12176995
GO:0036064	Component	Ciliary basal body	ISS

Other IDs

• MIM: 601402
• HGNC: 7125
• e!Ensembl: ENSG00000178053

Protein

• UniProt ID: P58340
• Protein name: Myeloid leukemia factor 1 (Myelodysplasia-myeloid leukemia factor 1)
• Protein function: Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the
• PDB: 3UAL, 3UBW, 6Y8E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10248	Mlf1IP	26 → 202	Myelodysplasia-myeloid leukemia factor 1-interacting protein	Family

• Sequence:

  MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG
  EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEP
  PKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEV
  NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQS
  PAIEHGRRSNVLGDKLHIKGSSVKSNKK

• Sequence length: 268

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601

Unknown
Disease name	Disease term	dbSNP ID	References
Myeloid leukemia	Acute Myeloid Leukemia, M1
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923