GediPNet logo

CXCL9 (C-X-C motif chemokine ligand 9)
Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4283
Gene nameGene Name - the full gene name approved by the HGNC.
C-X-C motif chemokine ligand 9
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CXCL9
SynonymsGene synonyms aliases
CMK, Humig, MIG, SCYB9, crg-10
ChromosomeChromosome number
4
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.1
SummarySummary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Aug 2020]
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT016944 hsa-miR-335-5p Microarray 18185580
MIRT025283 hsa-miR-34a-5p Proteomics 21566225
MIRT028888 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity TAS 2115167
GO:0005515 Function Protein binding IPI 18275857, 21314817, 25416956, 28381538, 31515488, 32296183
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0006935 Process Chemotaxis IDA 12782716
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q07325
Protein name C-X-C motif chemokine 9 (Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (HuMIG) (MIG) (Small-inducible cytokine B9)
Protein function Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8
29 → 89
Small cytokines (intecrine/chemokine), interleukin-8 like
 Domain
Sequence 
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
Sequence length 125
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Disease name Disease term References
Alopecia Areata
Biliary cirrhosis
Biliary Cirrhosis, Primary, 1
Primary biliary cirrhosis
Malignant neoplasm of breast

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412