GediPNet logo

MGP (matrix Gla protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4256
Gene nameGene Name - the full gene name approved by the HGNC.
Matrix Gla protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MGP
SynonymsGene synonyms aliases
GIG36, MGLAP, NTI
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p12.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the osteocalcin/matrix Gla family of proteins. The encoded vitamin K-dependent protein is secreted by chondrocytes and vascular smooth muscle cells, and functions as a physiological inhibitor of ectopic tissue calcification.
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs111320759 C>T Pathogenic-likely-pathogenic, pathogenic Splice donor variant
rs112518413 T>A,C Pathogenic Splice acceptor variant
rs730880321 C>- Pathogenic Coding sequence variant, stop gained
rs730880322 A>G,T Pathogenic Coding sequence variant, stop gained, synonymous variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017975 hsa-miR-335-5p Microarray 18185580
MIRT029487 hsa-miR-26b-5p Microarray 19088304
MIRT1147531 hsa-miR-1273f CLIP-seq
MIRT1147532 hsa-miR-1303 CLIP-seq
MIRT1147533 hsa-miR-135a CLIP-seq
Transcription factors
Transcription factor Regulation Reference
JUN Unknown 11425864
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001502 Process Cartilage condensation TAS 9916809
GO:0001503 Process Ossification IEA
GO:0005201 Function Extracellular matrix structural constituent RCA 20551380, 23979707, 27068509, 27559042
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 15607035
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P08493
Protein name Matrix Gla protein (MGP) (Cell growth-inhibiting gene 36 protein)
Protein function Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
Family and domains
Sequence
MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRE
RSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK
Sequence length 103
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 16316942, 12376462, 12376462, 16316942
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Hypertension Hypertensive disease rs13306026, rs13333226
Keutel syndrome Keutel syndrome rs730880321, rs112518413, rs730880322, rs111320759 15810001, 21705322, 9916809
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia
Anaplastic carcinoma Anaplastic carcinoma 16316942, 12376462
Bronchitis Recurrent bronchitis
Congenital atresia of trachea Congenital atresia of trachea

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412