GediPNet logo

MCL1 (MCL1 apoptosis regulator, BCL2 family member)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4170
Gene nameGene Name - the full gene name approved by the HGNC.
MCL1 apoptosis regulator, BCL2 family member
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MCL1
SynonymsGene synonyms aliases
BCL2L3, EAT, MCL1-ES, MCL1L, MCL1S, Mcl-1, TM, bcl2-L-3, mcl1/EAT
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively s
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003287 hsa-miR-29b-3p Luciferase reporter assay, Western blot, Immunofluorescence 17404574
MIRT003287 hsa-miR-29b-3p Luciferase reporter assay, Western blot, Immunofluorescence 17404574
MIRT003260 hsa-miR-133b Western blot 19654003
MIRT003260 hsa-miR-133b Luciferase reporter assay 19654003
MIRT000878 hsa-miR-15a-5p Microarray 18362358
Transcription factors
Transcription factor Regulation Reference
ATF4 Unknown 22128141
ATM Activation 20164679
DDIT3 Unknown 22253918
E2F1 Repression 11705881
ELK1 Unknown 9880563
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001709 Process Cell fate determination NAS 10837489
GO:0005515 Function Protein binding IPI 15901672, 16697956, 17097560, 17428862, 17525735, 18040043, 18981409, 19074266, 19605477, 19968986, 20023629, 20085765, 21132008, 21139567, 21199865, 21454712, 21458670, 21507240, 22277751, 22516262, 23055042, 23245996, 23680104, 24113155, 26431330, 26859456, 27013495, 28514442, 322
GO:0005634 Component Nucleus IDA 20467439
GO:0005654 Component Nucleoplasm IEA
GO:0005737 Component Cytoplasm TAS 10837489
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q07820
Protein name Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT)
Protein function Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isofor
PDB 2KBW , 2MHS , 2NL9 , 2NLA , 2PQK , 3D7V , 3IO9 , 3KJ0 , 3KJ1 , 3KJ2 , 3KZ0 , 3MK8 , 3PK1 , 3TWU , 3WIX , 3WIY , 4BPI , 4BPJ , 4HW2 , 4HW3 , 4HW4 , 4OQ5 , 4OQ6 , 4WGI , 4WMR , 4WMS , 4WMT , 4WMU , 4WMV , 4WMW , 4WMX , 4ZBF , 4ZBI , 5C3F , 5C6H , 5FC4 , 5FDO , 5FDR , 5IEZ , 5IF4 , 5JSB , 5KU9 , 5LOF , 5MES , 5MEV , 5UUM , 5VKC , 5VX2 , 5W89 , 5W8F , 6B4L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00452 Bcl-2
213 312
Apoptosis regulator proteins, Bcl-2 family
Family
Sequence
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGW
DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Sequence length 350
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  PI3K-Akt signaling pathway
Apoptosis
JAK-STAT signaling pathway
MicroRNAs in cancer
  Interleukin-4 and Interleukin-13 signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 19903766, 27935865
Lymphoma Lymphoma, T-Cell, Cutaneous rs11540652, rs1592119138, rs1592123162, rs1599367044 12754746
Multiple myeloma Multiple Myeloma rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962, rs751524927, rs1575079076, rs1575446356, rs1478603808, rs1578264146, rs1578673280, rs1579484570, rs1579491104, rs1171390403, rs1582867955, rs764264135, rs951047896, rs890521687, rs1581495906, rs1587941402, rs1003155450, rs1588299621, rs1591100766, rs1591693095, rs1029296641, rs1593107841, rs1208575764, rs1593835248, rs1594406727, rs1594966387, rs1595889508, rs1159294530, rs1597073318, rs1135402871, rs1599413207, rs1418268495, rs1212577459, rs1600394490, rs1455074519, rs1603113792, rs1603415028, rs1602247047, rs1603452612 12429644
Sarcoma Sarcoma, Epithelioid, Sarcoma, Spindle Cell, Sarcoma rs11540652, rs104886003, rs137852790, rs1555927374 15217956
Unknown
Disease name Disease term dbSNP ID References
Barrett epithelium Barrett Epithelium 21127259
Barrett esophagus Barrett Esophagus rs41341748 21127259
Granulomatous slack skin Granulomatous Slack Skin 12754746
Lung neoplasms Lung Neoplasms 27935865, 19903766

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412