GediPNet logo

MBP (myelin basic protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4155
Gene nameGene Name - the full gene name approved by the HGNC.
Myelin basic protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MBP
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
18
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q23
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs ar
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT734679 hsa-miR-665 RNA-seq, qRT-PCR, Immunocytochemistry (ICC), ELISA 31775315
MIRT738748 hsa-miR-759 HITS-CLIP 33718276
MIRT1136004 hsa-miR-1257 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NF1 Unknown 9765312
NFIB Activation 1699939
SOX10 Unknown 11734543
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 22524708
GO:0002020 Function Protease binding IEA
GO:0005515 Function Protein binding IPI 25416956, 28298427, 31515488
GO:0005516 Function Calmodulin binding IPI 19855925
GO:0005634 Component Nucleus IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P02686
Protein name Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
Protein function The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important
PDB 1BX2 , 1FV1 , 1HQR , 1K2D , 1YMM , 1ZGL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01669 Myelin_MBP
149 304
Myelin basic protein
Family
Sequence
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG
GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG
RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
MARR
Sequence length 304
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    EGR2 and SOX10-mediated initiation of Schwann cell myelination
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212 21673997
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 24788877, 22675524, 19154657, 16213148
Unknown
Disease name Disease term dbSNP ID References
Demyelinating diseases Demyelinating Diseases, Clinically Isolated Syndrome, CNS Demyelinating 2580064
Neuromyelitis optica Neuromyelitis Optica 18509235

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412