MAOB (monoamine oxidase B)

Gene

• Entrez ID: 4129
• Gene name: Monoamine oxidase B
• Gene symbol: MAOB
• Synonyms: -
• Chromosome: X
• Chromosome location: Xp11.3
• Summary: The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT1127646	hsa-miR-1185	CLIP-seq
MIRT1127647	hsa-miR-1252	CLIP-seq
MIRT1127648	hsa-miR-2114	CLIP-seq
MIRT1127649	hsa-miR-3173-3p	CLIP-seq
MIRT1127650	hsa-miR-3679-5p	CLIP-seq
MIRT1127651	hsa-miR-4270	CLIP-seq
MIRT1127652	hsa-miR-4441	CLIP-seq
MIRT1127653	hsa-miR-4474-3p	CLIP-seq
MIRT1127654	hsa-miR-599	CLIP-seq
MIRT1127655	hsa-miR-760	CLIP-seq
MIRT2266488	hsa-miR-3650	CLIP-seq
MIRT2438474	hsa-miR-490-5p	CLIP-seq
MIRT2438475	hsa-miR-511	CLIP-seq
MIRT2453644	hsa-miR-3125	CLIP-seq
MIRT2453645	hsa-miR-3613-3p	CLIP-seq
MIRT2453646	hsa-miR-3916	CLIP-seq
MIRT2453647	hsa-miR-4668-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDCA7L	Repression	20980443
EAPP	Repression	20980443
RARA	Unknown	19401466
SP1	Unknown	11259630;20980443
SP3	Unknown	11259630
SP4	Activation	11259630

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 30021884, 32296183, 32814053
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005740	Component	Mitochondrial envelope	TAS	7063850
GO:0005741	Component	Mitochondrial outer membrane	TAS	24252804
GO:0008131	Function	Primary amine oxidase activity	IEA
GO:0009055	Function	Electron transfer activity	TAS	8602220
GO:0009636	Process	Response to toxic substance	IEA
GO:0010044	Process	Response to aluminum ion	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0014063	Process	Negative regulation of serotonin secretion	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022900	Process	Electron transport chain	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042135	Process	Neurotransmitter catabolic process	IEA
GO:0042420	Process	Dopamine catabolic process	TAS	24252804
GO:0042493	Process	Response to drug	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045964	Process	Positive regulation of dopamine metabolic process	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	NAS	24252804
GO:0051412	Process	Response to corticosterone	IEA

Other IDs

• MIM: 309860
• HGNC: 6834
• e!Ensembl: ENSG00000069535

Protein

• UniProt ID: P27338
• Protein name: Amine oxidase [flavin-containing] B (EC 1.4.3.21) (EC 1.4.3.4) (Monoamine oxidase type B) (MAO-B)
• Protein function: Catalyzes the oxidative deamination of primary and some secondary amines such as neurotransmitters, and exogenous amines including the tertiary amine, neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), with concomitant reduction of
• PDB: 1GOS, 1OJ9, 1OJA, 1OJC, 1OJD, 1S2Q, 1S2Y, 1S3B, 1S3E, 2BK3, 2BK4, 2BK5, 2BYB, 2C64, 2C65, 2C66, 2C67, 2C70, 2C72, 2C73, 2C75, 2C76, 2V5Z, 2V60, 2V61, 2VRL, 2VRM, 2VZ2, 2XCG, 2XFN, 2XFO, 2XFP, 2XFQ, 2XFU, 3PO7, 3ZYX, 4A79, 4A7A, 4CRT, 5MRL, 6FVZ, 6FW0, 6FWC, 6RKB, 6RKP, 6RLE, 6YT2, 7B0V, 7B0Z, 7P4F, 7P4H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01593	Amino_oxidase	14 → 451	Flavin containing amine oxidoreductase	Domain

• Sequence:

  MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
  VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
  TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
  SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
  TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
  YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
  LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
  IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
  FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV

• Sequence length: 520

Pathways

KEGG:

Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Parkinson disease
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	21075085, 7816197, 7816197, 21075085
Anemia	Anemia, Megaloblastic	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505	7430361
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	19221690
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925
Parkinson disease	Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	21318773
Pheochromocytoma	Pheochromocytoma	rs121908826, rs121908830, rs121908821, rs5030821, rs5030820, rs104893826, rs5030808, rs587776644, rs80338844, rs104894306, rs104894309, rs75076352, rs75996173, rs77709286, rs74799832, rs387906651, rs121908813, rs121908822, rs121908814, rs121908825, rs121908827, rs121908829, rs121908831, rs121908815, rs587781773, rs786203251, rs786202100, rs864321636, rs864321638, rs864321639, rs864321643, rs864321641, rs864321642, rs864321640, rs864321644, rs876659130, rs876658477, rs878854594, rs886039439, rs886041237, rs121908816, rs1131691061, rs760169139, rs780133289, rs1558752379	22569243
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20479760

Unknown
Disease name	Disease term	dbSNP ID	References
Akinetic-rigid variant of huntington disease	Akinetic-Rigid Variant of Huntington Disease		21075085
Bipolar disorder	Bipolar Disorder		10686545, 7485270, 9342194
Endometrioma	Endometrioma		21063030
Endometriosis	Endometriosis	rs1800629, rs1143634	21063030
Extra-adrenal pheochromocytoma	Pheochromocytoma, Extra-Adrenal		22569243
Fulminant hepatic failure with cerebral edema	Fulminant Hepatic Failure with Cerebral Edema		10564534
Hepatic coma	Hepatic Coma		10564534
Hepatic encephalopathy	Hepatic Encephalopathy		10564534
Hepatic stupor	Hepatic Stupor		10564534
Huntington disease	Huntington Disease, Huntington Disease, Late Onset, Juvenile Huntington Disease	rs768047421	21075085
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	19268543, 22414661, 19657584, 19657584, 19268543, 22414661, 17640790, 19657584, 19657584, 17640790
Mood disorder	Mood Disorders		10686545, 9342198, 9342194
Senile dementia	Presenile dementia, Acute Confusional Senile Dementia		21075085, 7816197, 7816197, 21075085
Senile plaques	Senile Plaques		7816197