LTF (lactotransferrin)

Gene

• Entrez ID: 4057
• Gene name: Lactotransferrin
• Gene symbol: LTF
• Synonyms: GIG12, HEL110, HLF2, LF
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an import

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
CEBPE	Unknown	12522000
SP1	Unknown	10845904

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001530	Function	Lipopolysaccharide binding	IMP	15155221
GO:0001817	Process	Regulation of cytokine production	IDA	20345905
GO:0001895	Process	Retina homeostasis	HEP	23580065
GO:0002227	Process	Innate immune response in mucosa	IDA	12037568
GO:0003677	Function	DNA binding	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	12788072
GO:0005506	Function	Iron ion binding	IDA	12037568
GO:0005515	Function	Protein binding	IPI	1544444, 9223490, 12522210, 17567961, 25193851, 27616280
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12788072, 17567961, 18714013
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IMP	25193851
GO:0005769	Component	Early endosome	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006508	Process	Proteolysis	IEA
GO:0006826	Process	Iron ion transport	IBA	21873635
GO:0006959	Process	Humoral immune response	TAS	9770539
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0009986	Component	Cell surface	IDA	17567961
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0019731	Process	Antibacterial humoral response	IBA	21873635
GO:0019731	Process	Antibacterial humoral response	IDA	1599934, 18714013
GO:0019732	Process	Antifungal humoral response	IDA	11083624
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0031640	Process	Killing of cells of other organism	IDA	9727055
GO:0031640	Process	Killing of cells of other organism	IMP	15155221
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	20345905
GO:0032680	Process	Regulation of tumor necrosis factor production	IDA	20345905
GO:0032780	Process	Negative regulation of ATPase activity	IMP	25193851
GO:0032991	Component	Protein-containing complex	IDA	17567961
GO:0033214	Process	Siderophore-dependent iron import into cell	TAS
GO:0033690	Process	Positive regulation of osteoblast proliferation	IDA	15166119
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IMP	20345905
GO:0035580	Component	Specific granule lumen	TAS
GO:0042581	Component	Specific granule	IDA	2981589
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	20345905
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	20345905
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0044793	Process	Negative regulation by host of viral process	IMP	12522210
GO:0045071	Process	Negative regulation of viral genome replication	IMP	25193851
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	15166119
GO:0048525	Process	Negative regulation of viral process	IMP	25193851
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	15155221
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	20345905
GO:0051673	Process	Membrane disruption in other organism	IMP	15155221
GO:0055037	Component	Recycling endosome	IBA	21873635
GO:0060349	Process	Bone morphogenesis	IDA	15166119
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	15155221
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	20345905
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1900159	Process	Positive regulation of bone mineralization involved in bone maturation	ISS
GO:1900229	Process	Negative regulation of single-species biofilm formation in or on host organism	IDA	12037568
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IDA	15166119
GO:1904724	Component	Tertiary granule lumen	TAS
GO:2000117	Process	Negative regulation of cysteine-type endopeptidase activity	IDA	12788072
GO:2000308	Process	Negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS
GO:2001205	Process	Negative regulation of osteoclast development	ISS

Other IDs

• MIM: 150210
• HGNC: 6720
• e!Ensembl: ENSG00000012223

Protein

• UniProt ID: P02788
• Protein name: Lactotransferrin (Lactoferrin) (EC 3.4.21.-) (Growth-inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin-H (Lfcin-H); Kaliocin-1; Lactoferroxin-A; Lactoferroxin-B; Lactoferroxin-C]
• Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. ; [Lactotransferrin]: Major iron-binding and multifunctiona
• PDB: 1B0L, 1BKA, 1CB6, 1DSN, 1EH3, 1FCK, 1H43, 1H44, 1H45, 1HSE, 1L5T, 1LCF, 1LCT, 1LFG, 1LFH, 1LFI, 1LGB, 1N76, 1SQY, 1U62, 1VFD, 1VFE, 1XV4, 1XV7, 1Z6V, 1Z6W, 2BJJ, 2DP4, 2GMC, 2GMD, 2HD4, 2PMS, 7JRD, 7N88
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00405	Transferrin	25 → 352	Transferrin	Domain
  PF00405	Transferrin	364 → 695	Transferrin	Domain

• Sequence:

  MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
  PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
  GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA
  DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE
  AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
  KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR
  RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
  AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT
  AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS
  NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
  PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL
  LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

• Sequence length: 710

Pathways

Reactome:

Mtb iron assimilation by chelation
Neutrophil degranulation
Metal sequestration by antimicrobial proteins
Antimicrobial peptides
Amyloid fiber formation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	12079509
Hypertension	Hypertensive disease	rs13306026, rs13333226	24587916
Osteoporosis	Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	16936800, 16648989, 16648989, 16936800

Unknown
Disease name	Disease term	dbSNP ID	References
Arthropathy	Arthropathy		16640825
Benign neoplasm	Benign Neoplasm		16640825
Endometrioma	Endometrioma		21063030
Endometriosis	Endometriosis	rs1800629, rs1143634	21063030
Liver neoplasms	Liver neoplasms		12079509
Liver cancer	Malignant neoplasm of liver		12079509
Malignant neoplasm	Malignant Neoplasms		16640825
Necrotizing enterocolitis	Necrotizing Enterocolitis		16640825
Neoplasms	Neoplasms		16640825
Oral ulcer	Oral Ulcer		30837455
Ulcerative colitis	Ulcerative Colitis		16640825