LTBR (lymphotoxin beta receptor)

Gene

• Entrez ID: 4055
• Gene name: Lymphotoxin beta receptor
• Gene symbol: LTBR
• Synonyms: D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027696	hsa-miR-98-5p	Microarray	19088304
MIRT641725	hsa-miR-9500	HITS-CLIP	23824327
MIRT641724	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT641723	hsa-miR-4533	HITS-CLIP	23824327
MIRT641722	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT641721	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT641720	hsa-miR-6883-3p	HITS-CLIP	23824327
MIRT734365	hsa-miR-29a-3p	Luciferase reporter assay, Western blotting	33602223
MIRT641725	hsa-miR-9500	HITS-CLIP	23824327
MIRT641724	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT641723	hsa-miR-4533	HITS-CLIP	23824327
MIRT641722	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT641721	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT641720	hsa-miR-6883-3p	HITS-CLIP	23824327
MIRT1122183	hsa-miR-1182	CLIP-seq
MIRT1122184	hsa-miR-1255a	CLIP-seq
MIRT1122185	hsa-miR-1255b	CLIP-seq
MIRT1122186	hsa-miR-1273g	CLIP-seq
MIRT1122187	hsa-miR-127-5p	CLIP-seq
MIRT1122188	hsa-miR-1909	CLIP-seq
MIRT1122189	hsa-miR-2110	CLIP-seq
MIRT1122190	hsa-miR-29a	CLIP-seq
MIRT1122191	hsa-miR-29b	CLIP-seq
MIRT1122192	hsa-miR-29c	CLIP-seq
MIRT1122193	hsa-miR-3150a-3p	CLIP-seq
MIRT1122194	hsa-miR-3190	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT1122196	hsa-miR-3616-5p	CLIP-seq
MIRT1122197	hsa-miR-3647-5p	CLIP-seq
MIRT1122198	hsa-miR-3663-3p	CLIP-seq
MIRT1122199	hsa-miR-3911	CLIP-seq
MIRT1122200	hsa-miR-3921	CLIP-seq
MIRT1122201	hsa-miR-409-5p	CLIP-seq
MIRT1122202	hsa-miR-4450	CLIP-seq
MIRT1122203	hsa-miR-4453	CLIP-seq
MIRT1122204	hsa-miR-4538	CLIP-seq
MIRT1122205	hsa-miR-455-3p	CLIP-seq
MIRT1122206	hsa-miR-4653-5p	CLIP-seq
MIRT1122207	hsa-miR-4795-5p	CLIP-seq
MIRT1122208	hsa-miR-573	CLIP-seq
MIRT1122209	hsa-miR-593	CLIP-seq
MIRT1122210	hsa-miR-595	CLIP-seq
MIRT1122183	hsa-miR-1182	CLIP-seq
MIRT2034530	hsa-miR-1250	CLIP-seq
MIRT1122186	hsa-miR-1273g	CLIP-seq
MIRT1122188	hsa-miR-1909	CLIP-seq
MIRT2034531	hsa-miR-1910	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT1122201	hsa-miR-409-5p	CLIP-seq
MIRT2034532	hsa-miR-4264	CLIP-seq
MIRT2034533	hsa-miR-4469	CLIP-seq
MIRT1122205	hsa-miR-455-3p	CLIP-seq
MIRT2034534	hsa-miR-4655-3p	CLIP-seq
MIRT2034535	hsa-miR-4777-3p	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT2264990	hsa-miR-4659a-5p	CLIP-seq
MIRT2264991	hsa-miR-4659b-5p	CLIP-seq
MIRT2264992	hsa-miR-4776-3p	CLIP-seq
MIRT2390395	hsa-miR-1915	CLIP-seq
MIRT2390396	hsa-miR-4323	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
WWTR1	Activation	22470139

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	8995654, 12393901, 20732415, 26977880, 28514442, 32296183
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	8171323
GO:0016021	Component	Integral component of membrane	IEA
GO:0016032	Process	Viral process	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	20732415
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0046330	Process	Positive regulation of JNK cascade	IMP	20732415
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	20732415

Other IDs

• MIM: 600979
• HGNC: 6718
• e!Ensembl: ENSG00000111321

Protein

• UniProt ID: P36941
• Protein name: Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III)
• Protein function: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT (PubMed:24248355). Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA(1)-LTB(2)) (PubMed:24248355). Promotes apoptosis via TRAF3
• PDB: 1RF3, 4MXW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	43 → 80	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	83 → 124	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	163 → 210	TNFR/NGFR cysteine-rich region	Domain

• Sequence:

  MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
  RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
  KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
  PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
  ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
  VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
  IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
  TPSNRGPRNQFITHD

• Sequence length: 435

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NF-kappa B signaling pathway
HIF-1 signaling pathway
Intestinal immune network for IgA production
Human T-cell leukemia virus 1 infection
Viral carcinogenesis

Reactome:

TNFR2 non-canonical NF-kB pathway
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Systemic onset juvenile chronic arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	23603761
Rheumatoid arthritis	Rheumatoid Arthritis, Systemic Juvenile	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	23603761

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		23749187
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	26192919, 28067908
Oligoarticular arthritis	Oligoarticular Juvenile Idiopathic Arthritis		23603761
Pauciarticular chronic arthritis	Juvenile pauciarticular chronic arthritis		23603761
Seronegative polyarthritis	Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative		23603761
Biliary cirrhosis	Primary biliary cirrhosis		22961000
Still disease	Juvenile-Onset Still Disease		23603761