Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
402117 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Von Willebrand factor C domain containing 2 like |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
VWC2L |
SynonymsGene synonyms aliases
|
- |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2q34-q35 |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
B2RUY7 |
Protein name |
von Willebrand factor C domain-containing protein 2-like (VWC2-like protein) (Brorin-like) |
Protein function |
May play a role in neurogenesis. May play a role in bone differentiation and matrix mineralization. |
Family and domains |
|
Sequence |
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
|
|
Sequence length |
222 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Schizophrenia |
Schizophrenia |
rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 |
31374203 |
|
|