GediPNet logo

VWC2L (von Willebrand factor C domain containing 2 like)
Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
402117
Gene nameGene Name - the full gene name approved by the HGNC.
Von Willebrand factor C domain containing 2 like
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
VWC2L
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q34-q35
miRNAmiRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT609779 hsa-miR-4464 HITS-CLIP 19536157
MIRT609778 hsa-miR-4748 HITS-CLIP 19536157
MIRT609777 hsa-miR-329-5p HITS-CLIP 19536157
MIRT609776 hsa-miR-1304-3p HITS-CLIP 19536157
MIRT609775 hsa-miR-1229-3p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 27107012, 32296183
GO:0005615 Component Extracellular space IBA 21873635
GO:0007275 Process Multicellular organism development IEA
GO:0030514 Process Negative regulation of BMP signaling pathway IBA 21873635
GO:0032281 Component AMPA glutamate receptor complex IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID B2RUY7
Protein name von Willebrand factor C domain-containing protein 2-like (VWC2-like protein) (Brorin-like)
Protein function May play a role in neurogenesis. May play a role in bone differentiation and matrix mineralization.
Family and domains
Sequence 
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
Sequence length 222
Interactions View interactions
Associated diseases
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 31374203
Unknown
Disease name Disease term dbSNP ID References
Mental depression Major Depressive Disorder rs587778876, rs587778877 29942085
Mood disorder Mood Disorders 29942085

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412