LMO2 (LIM domain only 2)

Gene

• Entrez ID: 4005
• Gene name: LIM domain only 2
• Gene symbol: LMO2
• Synonyms: LMO-2, RBTN2, RBTNL1, RHOM2, TTG2
• Chromosome: 11
• Chromosome location: 11p13
• Summary: LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approxima

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000130	hsa-miR-223-3p	Review	20029422
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	19278969
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	19278969
MIRT000130	hsa-miR-223-3p	Reporter assay	19017354
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, RNA-binding protein immunoprecipitation, Western blot	28303002
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, RNA-binding protein immunoprecipitation, Western blot	28303002
MIRT1111875	hsa-miR-136	CLIP-seq
MIRT1111876	hsa-miR-3189-3p	CLIP-seq
MIRT1111877	hsa-miR-4328	CLIP-seq
MIRT1111878	hsa-miR-502-5p	CLIP-seq
MIRT2262023	hsa-miR-4477a	CLIP-seq
MIRT2262024	hsa-miR-616	CLIP-seq
MIRT2262025	hsa-miR-622	CLIP-seq
MIRT2453075	hsa-miR-1245b-5p	CLIP-seq
MIRT2453076	hsa-miR-3142	CLIP-seq
MIRT1111876	hsa-miR-3189-3p	CLIP-seq
MIRT2453077	hsa-miR-4720-3p	CLIP-seq
MIRT2453078	hsa-miR-4753-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Activation	20686118
PRDM1	Repression	21722313

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IPI	16314316
GO:0001221	Function	Transcription coregulator binding	IPI	16314316
GO:0003713	Function	Transcription coactivator activity	IDA	16314316
GO:0005515	Function	Protein binding	IPI	16189514, 16314316, 21516116, 21988832, 25416956, 29892012, 31515488
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	16314316
GO:0007275	Process	Multicellular organism development	TAS	1923511
GO:0043425	Function	BHLH transcription factor binding	IPI	16314316
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16314316
GO:0046872	Function	Metal ion binding	IEA
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IDA	19375645
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 180385
• HGNC: 6642
• e!Ensembl: ENSG00000135363

Protein

• UniProt ID: P25791
• Protein name: Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2)
• Protein function: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
• PDB: 2XJY, 2XJZ, 2YPA, 4KFZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	30 → 88	LIM domain	Domain
  PF00412	LIM	94 → 152	LIM domain	Domain

• Sequence:

  MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
  GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
  KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

• Sequence length: 158

Pathways

KEGG:

Transcriptional misregulation in cancer

Reactome:

RUNX1 regulates transcription of genes involved in differentiation of HSCs

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lymphoblastic leukemia	Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591	24394663, 19246562

Unknown
Disease name	Disease term	dbSNP ID	References
T-cell leukemia	Leukemia, T-Cell		2034676