LMO1 (LIM domain only 1)

Gene

• Entrez ID: 4004
• Gene name: LIM domain only 1
• Gene symbol: LMO1
• Synonyms: RBTN1, RHOM1, TTG1
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1111866	hsa-miR-181a	CLIP-seq
MIRT1111867	hsa-miR-181b	CLIP-seq
MIRT1111868	hsa-miR-181c	CLIP-seq
MIRT1111869	hsa-miR-181d	CLIP-seq
MIRT1111870	hsa-miR-3163	CLIP-seq
MIRT1111871	hsa-miR-4261	CLIP-seq
MIRT1111872	hsa-miR-4262	CLIP-seq
MIRT1111873	hsa-miR-494	CLIP-seq
MIRT1111874	hsa-miR-543	CLIP-seq
MIRT2262020	hsa-miR-4438	CLIP-seq
MIRT2262021	hsa-miR-4494	CLIP-seq
MIRT2262022	hsa-miR-5095	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARX	Unknown	23771350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 27107012, 31515488, 32296183
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20855495
GO:0046013	Process	Regulation of T cell homeostatic proliferation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 186921
• HGNC: 6641
• e!Ensembl: ENSG00000166407

Protein

• UniProt ID: P25800
• Protein name: Rhombotin-1 (Cysteine-rich protein TTG-1) (LIM domain only protein 1) (LMO-1) (T-cell translocation protein 1)
• Protein function: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	24 → 82	LIM domain	Domain
  PF00412	LIM	88 → 146	LIM domain	Domain

• Sequence:

  MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
  VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN
  QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

• Sequence length: 156

Pathways

Reactome:

RUNX1 regulates transcription of genes involved in differentiation of HSCs

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lymphoblastic leukemia	Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591	19246562
Neuroblastoma	Neuroblastoma	rs121908161, rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544	21124317, 22941191, 28545128, 26560027

Unknown
Disease name	Disease term	dbSNP ID	References
Nervous system neoplasms	Nervous System Neoplasms
Neural crest tumor	Neural crest tumor		26560027
T-cell leukemia	Leukemia, T-Cell		3259177, 2034676