LGALS3 (galectin 3)

Gene

• Entrez ID: 3958
• Gene name: Galectin 3
• Gene symbol: LGALS3
• Synonyms: CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2
• Chromosome: 14
• Chromosome location: 14q22.3
• Summary: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003969	hsa-miR-424-3p	Northern blot, qRT-PCR, Western blot	17889671
MIRT037600	hsa-miR-744-5p	CLASH	23622248
MIRT755578	hsa-miR-128-3p	Luciferase reporter assay, qRT-PCR, Western blot	28146425
MIRT755578	hsa-miR-128-3p	Western blotting, qRT-PCR	34811696
MIRT1108215	hsa-miR-1208	CLIP-seq
MIRT1108216	hsa-miR-2054	CLIP-seq
MIRT1108217	hsa-miR-4420	CLIP-seq
MIRT1108218	hsa-miR-4760-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Activation	16285957
RUNX1	Activation	19020999
RUNX2	Activation	19020999

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IBA	21873635
GO:0001772	Component	Immunological synapse	IDA	19706535
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002548	Process	Monocyte chemotaxis	IDA	10925302
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004864	Function	Protein phosphatase inhibitor activity	IC	24846175
GO:0005515	Function	Protein binding	IPI	2402511, 19016746, 19706535, 20812334, 21712812, 24945728, 25315772, 25416956, 29427412, 31515488, 31540324, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	7682704, 14961764, 22761016
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	9447709, 14961764, 22761016
GO:0005743	Component	Mitochondrial inner membrane	IDA	19016746
GO:0005886	Component	Plasma membrane	TAS
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0019863	Function	IgE binding	IBA	21873635
GO:0019863	Function	IgE binding	IDA	2261464
GO:0019903	Function	Protein phosphatase binding	IPI	24846175
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0030593	Process	Neutrophil chemotaxis	IDA	10925302
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	24846175
GO:0042056	Function	Chemoattractant activity	IDA	10925302
GO:0042129	Process	Regulation of T cell proliferation	IMP	8692888
GO:0043236	Function	Laminin binding	IBA	21873635
GO:0043236	Function	Laminin binding	IDA	2402511
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045637	Process	Regulation of myeloid cell differentiation	TAS
GO:0045806	Process	Negative regulation of endocytosis	IBA	21873635
GO:0045806	Process	Negative regulation of endocytosis	IDA	19706535
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IDA	10925302
GO:0048246	Process	Macrophage chemotaxis	IBA	21873635
GO:0048246	Process	Macrophage chemotaxis	IDA	10925302
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	ISS	19706535
GO:0050918	Process	Positive chemotaxis	IBA	21873635
GO:0050918	Process	Positive chemotaxis	IDA	10925302
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380, 28327460
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070232	Process	Regulation of T cell apoptotic process	IDA	8692888
GO:0071674	Process	Mononuclear cell migration	IDA	10925302
GO:0071677	Process	Positive regulation of mononuclear cell migration	IDA	10925302
GO:0090280	Process	Positive regulation of calcium ion import	IBA	21873635
GO:0090280	Process	Positive regulation of calcium ion import	IDA	10925302
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	8692888
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	24846175
GO:1903614	Process	Negative regulation of protein tyrosine phosphatase activity	IC	24846175
GO:2000521	Process	Negative regulation of immunological synapse formation	ISS	19706535
GO:2001189	Process	Negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	ISS	19706535
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IDA	16116184
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IBA	21873635
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	22761016

Other IDs

• MIM: 153619
• HGNC: 6563
• e!Ensembl: ENSG00000131981

Protein

• UniProt ID: P17931
• Protein name: Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
• Protein function: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during earl
• PDB: 1A3K, 1KJL, 1KJR, 2NMN, 2NMO, 2NN8, 2XG3, 3AYA, 3AYC, 3AYD, 3AYE, 3T1L, 3T1M, 3ZSJ, 3ZSK, 3ZSL, 3ZSM, 4BLI, 4BLJ, 4BM8, 4JC1, 4JCK, 4LBJ, 4LBK, 4LBL, 4LBM, 4LBN, 4LBO, 4R9A, 4R9B, 4R9C, 4R9D, 4RL7, 4XBN, 5E88, 5E89, 5E8A, 5EXO, 5H9P, 5H9R, 5IUQ, 5NF7, 5NF9, 5NFA, 5NFB, 5NFC, 5OAX, 5ODY, 6B8K, 6EOG, 6EOL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00337	Gal-bind_lectin	117 → 247	Galactoside-binding lectin	Domain

• Sequence:

  MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
  GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
  PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
  WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
  DLTSASYTMI

• Sequence length: 250

Pathways

Reactome:

Neutrophil degranulation
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells
RUNX2 regulates genes involved in differentiation of myeloid cells

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	17634542
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	21750908
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	23994248
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	29769800

Unknown
Disease name	Disease term	dbSNP ID	References
Cirrhosis	Cirrhosis	rs119465999, rs144369314, rs8056684, rs112053857, rs75998507	27870162
Miscarriage	Miscarriage		18539642
Nephritis	Nephritis		11044214
St segment elevation myocardial infarction	ST segment elevation myocardial infarction		29769800
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		21750908
Vascular diseases	Vascular Diseases		27870162