LBP (lipopolysaccharide binding protein)

Gene

• Entrez ID: 3929
• Gene name: Lipopolysaccharide binding protein
• Gene symbol: LBP
• Synonyms: BPIFD2
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeab

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017289	hsa-miR-335-5p	Microarray	18185580
MIRT050450	hsa-miR-22-3p	CLASH	23622248
MIRT045133	hsa-miR-186-5p	CLASH	23622248
MIRT1105367	hsa-miR-4299	CLIP-seq
MIRT1105368	hsa-miR-4709-3p	CLIP-seq
MIRT1105369	hsa-miR-501-3p	CLIP-seq
MIRT1105370	hsa-miR-502-3p	CLIP-seq
MIRT1105371	hsa-miR-765	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2683800	hsa-miR-3655	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2683801	hsa-miR-578	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Repression	15114678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001530	Function	Lipopolysaccharide binding	IMP	24120359
GO:0001530	Function	Lipopolysaccharide binding	ISS	2477488
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IBA	21873635
GO:0002281	Process	Macrophage activation involved in immune response	IMP	24120359
GO:0002281	Process	Macrophage activation involved in immune response	ISS	2402637
GO:0005102	Function	Signaling receptor binding	ISS	2477488
GO:0005515	Function	Protein binding	IPI	15294986, 21988832, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	2402637, 11528597, 24120359
GO:0005615	Component	Extracellular space	ISS	2477488
GO:0006953	Process	Acute-phase response	IBA	21873635
GO:0006953	Process	Acute-phase response	IEP	12932360
GO:0006953	Process	Acute-phase response	ISS	2477488
GO:0006968	Process	Cellular defense response	ISS	2402637
GO:0008228	Process	Opsonization	IC	12932360
GO:0008228	Process	Opsonization	ISS	2477488
GO:0009986	Component	Cell surface	IDA	11528597
GO:0015920	Process	Lipopolysaccharide transport	IDA	8985160
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA	21873635
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	8409400, 11739189
GO:0032490	Process	Detection of molecule of bacterial origin	IDA	11528597
GO:0032496	Process	Response to lipopolysaccharide	IDA	8409400, 11739189
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	11739189
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	8409400
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	8409400
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8409400, 12594207
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	24120359
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	2402637
GO:0033036	Process	Macromolecule localization	IDA	15294986
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	11528597
GO:0043032	Process	Positive regulation of macrophage activation	IBA	21873635
GO:0043032	Process	Positive regulation of macrophage activation	IDA	8409400
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IC	12932360
GO:0045087	Process	Innate immune response	ISS	2477488
GO:0045919	Process	Positive regulation of cytolysis	IDA	15294986
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	11528597
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS	2402637
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA	21873635
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12932360
GO:0060265	Process	Positive regulation of respiratory burst involved in inflammatory response	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	24120359
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071723	Function	Lipopeptide binding	IDA	15294986
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA

Other IDs

• MIM: 151990
• HGNC: 6517
• e!Ensembl: ENSG00000129988

Protein

• UniProt ID: P18428
• Protein name: Lipopolysaccharide-binding protein (LBP)
• Protein function: Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:24120359, PubMed:7517398). Acts as an affinity enhan
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01273	LBP_BPI_CETP	38 → 212	LBP / BPI / CETP family, N-terminal domain	Family
  PF02886	LBP_BPI_CETP_C	241 → 478	LBP / BPI / CETP family, C-terminal domain	Domain

• Sequence:

  MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
  DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
  SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
  FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
  QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
  FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
  YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
  AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
  V

• Sequence length: 481

Pathways

KEGG:

NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Alcoholic liver disease
Tuberculosis
Lipid and atherosclerosis

Reactome:

Toll Like Receptor 4 (TLR4) Cascade
Transfer of LPS from LBP carrier to CD14
Regulation of TLR by endogenous ligand
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	23349936
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	23349936

Unknown
Disease name	Disease term	dbSNP ID	References
Septicemia	Septicemia		22167001