SP5 (Sp5 transcription factor)

Gene

• Entrez ID: 389058
• Gene name: Sp5 transcription factor
• Gene symbol: SP5
• Synonyms: -
• Chromosome: 2
• Chromosome location: 2q31.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1381507	hsa-miR-103a	CLIP-seq
MIRT1381508	hsa-miR-107	CLIP-seq
MIRT1381509	hsa-miR-125a-5p	CLIP-seq
MIRT1381510	hsa-miR-125b	CLIP-seq
MIRT1381511	hsa-miR-1293	CLIP-seq
MIRT1381512	hsa-miR-142-3p	CLIP-seq
MIRT1381513	hsa-miR-15a	CLIP-seq
MIRT1381514	hsa-miR-15b	CLIP-seq
MIRT1381515	hsa-miR-16	CLIP-seq
MIRT1381516	hsa-miR-193a-5p	CLIP-seq
MIRT1381517	hsa-miR-195	CLIP-seq
MIRT1381518	hsa-miR-214	CLIP-seq
MIRT1381519	hsa-miR-300	CLIP-seq
MIRT1381520	hsa-miR-3179	CLIP-seq
MIRT1381521	hsa-miR-3202	CLIP-seq
MIRT1381522	hsa-miR-323-5p	CLIP-seq
MIRT1381523	hsa-miR-337-3p	CLIP-seq
MIRT1381524	hsa-miR-3619-5p	CLIP-seq
MIRT1381525	hsa-miR-3685	CLIP-seq
MIRT1381526	hsa-miR-381	CLIP-seq
MIRT1381527	hsa-miR-384	CLIP-seq
MIRT1381528	hsa-miR-3922-5p	CLIP-seq
MIRT1381529	hsa-miR-424	CLIP-seq
MIRT1381530	hsa-miR-4277	CLIP-seq
MIRT1381531	hsa-miR-4281	CLIP-seq
MIRT1381532	hsa-miR-4291	CLIP-seq
MIRT1381533	hsa-miR-4310	CLIP-seq
MIRT1381534	hsa-miR-4319	CLIP-seq
MIRT1381535	hsa-miR-4483	CLIP-seq
MIRT1381536	hsa-miR-4497	CLIP-seq
MIRT1381537	hsa-miR-4666-3p	CLIP-seq
MIRT1381538	hsa-miR-4728-5p	CLIP-seq
MIRT1381539	hsa-miR-4738-3p	CLIP-seq
MIRT1381540	hsa-miR-4747-5p	CLIP-seq
MIRT1381541	hsa-miR-4753-5p	CLIP-seq
MIRT1381542	hsa-miR-486-5p	CLIP-seq
MIRT1381543	hsa-miR-497	CLIP-seq
MIRT1381544	hsa-miR-548g	CLIP-seq
MIRT1381545	hsa-miR-615-5p	CLIP-seq
MIRT1381546	hsa-miR-624	CLIP-seq
MIRT1381547	hsa-miR-761	CLIP-seq
MIRT1381548	hsa-miR-922	CLIP-seq
MIRT2114183	hsa-miR-4772-3p	CLIP-seq
MIRT2114184	hsa-miR-891b	CLIP-seq
MIRT1381509	hsa-miR-125a-5p	CLIP-seq
MIRT1381510	hsa-miR-125b	CLIP-seq
MIRT2337107	hsa-miR-4287	CLIP-seq
MIRT1381534	hsa-miR-4319	CLIP-seq
MIRT2337108	hsa-miR-4469	CLIP-seq
MIRT2337109	hsa-miR-4685-3p	CLIP-seq
MIRT2337110	hsa-miR-4732-3p	CLIP-seq
MIRT2337111	hsa-miR-670	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA

Other IDs

• MIM: 609391
• HGNC: 14529
• e!Ensembl: ENSG00000204335

Protein

• UniProt ID: Q6BEB4
• Protein name: Transcription factor Sp5
• Protein function: Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	296 → 320	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	326 → 350	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	356 → 378	Zinc finger, C2H2 type	Domain

• Sequence:

  MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYD
  PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
  YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
  NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGAPHAPRFPASAAAAAAAAAALQRGL
  VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
  CGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL

• Sequence length: 398

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Unknown
Disease name	Disease term	dbSNP ID	References
Prostatic neoplasms	Prostatic Neoplasms		17013881