KCNS3 (potassium voltage-gated channel modifier subfamily S member 3)

Gene

• Entrez ID: 3790
• Gene name: Potassium voltage-gated channel modifier subfamily S member 3
• Gene symbol: KCNS3
• Synonyms: KV9.3
• Chromosome: 2
• Chromosome location: 2p24.2
• Summary: Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the contro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005009	hsa-miR-125b-5p	Microarray	17891175
MIRT022698	hsa-miR-124-3p	Microarray	18668037
MIRT024380	hsa-miR-215-5p	Microarray	19074876
MIRT026551	hsa-miR-192-5p	Microarray	19074876
MIRT1082462	hsa-miR-192	CLIP-seq
MIRT1082463	hsa-miR-215	CLIP-seq
MIRT1082464	hsa-miR-3646	CLIP-seq
MIRT1082465	hsa-miR-3919	CLIP-seq
MIRT1082466	hsa-miR-4269	CLIP-seq
MIRT2020521	hsa-miR-223	CLIP-seq
MIRT2020522	hsa-miR-3130-3p	CLIP-seq
MIRT2020523	hsa-miR-3908	CLIP-seq
MIRT2020524	hsa-miR-3942-3p	CLIP-seq
MIRT2020525	hsa-miR-4291	CLIP-seq
MIRT2020526	hsa-miR-4697-3p	CLIP-seq
MIRT2020527	hsa-miR-545	CLIP-seq
MIRT2020525	hsa-miR-4291	CLIP-seq
MIRT2020527	hsa-miR-545	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA	21873635
GO:0005251	Function	Delayed rectifier potassium channel activity	TAS	10484328
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006813	Process	Potassium ion transport	TAS	10484328
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0015459	Function	Potassium channel regulator activity	TAS	10484328
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0034765	Process	Regulation of ion transmembrane transport	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0051260	Process	Protein homooligomerization	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA	21873635

Other IDs

• MIM: 603888
• HGNC: 6302
• e!Ensembl: ENSG00000170745

Protein

• UniProt ID: Q9BQ31
• Protein name: Delayed-rectifier potassium channel regulatory subunit KCNS3 (Delayed-rectifier K(+) channel alpha subunit 3) (Delayed-rectifier potassium channel subunit Kv9.3) (Kv9.3) (Potassium voltage-gated channel subfamily S member 3)
• Protein function: Potassium channel regulatory subunit that modulates the delayed rectifier potassium channel activity of KCNB1 by namely slowing down the deactivation and inactivation time constants (PubMed:10484328). While it does not form functional channel on
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02214	BTB_2	17 → 116	BTB/POZ domain	Domain
  PF00520	Ion_trans	184 → 417	Ion transport protein	Family

• Sequence:

  MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
  SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
  YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
  CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
  LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
  LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
  WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
  VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDIC
  NTTSLENCTAK

• Sequence length: 491

Pathways

Reactome:

Voltage gated Potassium channels
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	24170294