KCND2 (potassium voltage-gated channel subfamily D member 2)

Gene

• Entrez ID: 3751
• Gene name: Potassium voltage-gated channel subfamily D member 2
• Gene symbol: KCND2
• Synonyms: KV4.2, RK5
• Chromosome: 7
• Chromosome location: 7q31.31
• Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1080701	hsa-miR-1	CLIP-seq
MIRT1080702	hsa-miR-1248	CLIP-seq
MIRT1080703	hsa-miR-1273f	CLIP-seq
MIRT1080704	hsa-miR-1297	CLIP-seq
MIRT1080705	hsa-miR-143	CLIP-seq
MIRT1080706	hsa-miR-183	CLIP-seq
MIRT1080707	hsa-miR-188-5p	CLIP-seq
MIRT1080708	hsa-miR-204	CLIP-seq
MIRT1080709	hsa-miR-206	CLIP-seq
MIRT1080710	hsa-miR-211	CLIP-seq
MIRT1080711	hsa-miR-26a	CLIP-seq
MIRT1080712	hsa-miR-26b	CLIP-seq
MIRT1080713	hsa-miR-3200-5p	CLIP-seq
MIRT1080714	hsa-miR-346	CLIP-seq
MIRT1080715	hsa-miR-3673	CLIP-seq
MIRT1080716	hsa-miR-4251	CLIP-seq
MIRT1080717	hsa-miR-4288	CLIP-seq
MIRT1080718	hsa-miR-4303	CLIP-seq
MIRT1080719	hsa-miR-4307	CLIP-seq
MIRT1080720	hsa-miR-4329	CLIP-seq
MIRT1080721	hsa-miR-4465	CLIP-seq
MIRT1080722	hsa-miR-4477b	CLIP-seq
MIRT1080723	hsa-miR-4539	CLIP-seq
MIRT1080724	hsa-miR-4659a-3p	CLIP-seq
MIRT1080725	hsa-miR-4659b-3p	CLIP-seq
MIRT1080726	hsa-miR-4672	CLIP-seq
MIRT1080727	hsa-miR-4698	CLIP-seq
MIRT1080728	hsa-miR-4708-5p	CLIP-seq
MIRT1080729	hsa-miR-4729	CLIP-seq
MIRT1080730	hsa-miR-4760-5p	CLIP-seq
MIRT1080731	hsa-miR-4770	CLIP-seq
MIRT1080732	hsa-miR-4778-3p	CLIP-seq
MIRT1080733	hsa-miR-4781-3p	CLIP-seq
MIRT1080734	hsa-miR-548ac	CLIP-seq
MIRT1080735	hsa-miR-548ae	CLIP-seq
MIRT1080736	hsa-miR-548aj	CLIP-seq
MIRT1080737	hsa-miR-548am	CLIP-seq
MIRT1080738	hsa-miR-548d-3p	CLIP-seq
MIRT1080739	hsa-miR-548x	CLIP-seq
MIRT1080740	hsa-miR-548z	CLIP-seq
MIRT1080741	hsa-miR-587	CLIP-seq
MIRT1080742	hsa-miR-599	CLIP-seq
MIRT1080743	hsa-miR-613	CLIP-seq
MIRT1080744	hsa-miR-632	CLIP-seq
MIRT1080745	hsa-miR-640	CLIP-seq
MIRT1080746	hsa-miR-654-3p	CLIP-seq
MIRT1080724	hsa-miR-4659a-3p	CLIP-seq
MIRT1080725	hsa-miR-4659b-3p	CLIP-seq
MIRT2020009	hsa-miR-1976	CLIP-seq
MIRT2020010	hsa-miR-2117	CLIP-seq
MIRT2020011	hsa-miR-324-5p	CLIP-seq
MIRT2020012	hsa-miR-3653	CLIP-seq
MIRT2020013	hsa-miR-4273	CLIP-seq
MIRT2020014	hsa-miR-4279	CLIP-seq
MIRT2020015	hsa-miR-4699-3p	CLIP-seq
MIRT1080730	hsa-miR-4760-5p	CLIP-seq
MIRT2251870	hsa-miR-3647-3p	CLIP-seq
MIRT2251871	hsa-miR-889	CLIP-seq
MIRT2389626	hsa-miR-4496	CLIP-seq
MIRT2389627	hsa-miR-4738-3p	CLIP-seq
MIRT2389628	hsa-miR-4803	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	TAS	11102480
GO:0005249	Function	Voltage-gated potassium channel activity	IBA	21873635
GO:0005249	Function	Voltage-gated potassium channel activity	IDA	24811166
GO:0005249	Function	Voltage-gated potassium channel activity	ISS
GO:0005249	Function	Voltage-gated potassium channel activity	NAS	11102480
GO:0005250	Function	A-type (transient outward) potassium channel activity	IBA	21873635
GO:0005250	Function	A-type (transient outward) potassium channel activity	IMP	15454437
GO:0005250	Function	A-type (transient outward) potassium channel activity	ISS
GO:0005515	Function	Protein binding	IPI	11287421, 14623880, 14980201, 15358149
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	24811166
GO:0007268	Process	Chemical synaptic transmission	TAS	11102480
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	15454437, 24811166
GO:0014069	Component	Postsynaptic density	IBA	21873635
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0019228	Process	Neuronal action potential	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0031226	Component	Intrinsic component of plasma membrane	IMP	15454437
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0034765	Process	Regulation of ion transmembrane transport	IEA
GO:0043197	Component	Dendritic spine	IBA	21873635
GO:0043197	Component	Dendritic spine	ISS
GO:0043197	Component	Dendritic spine	NAS	11102480
GO:0043204	Component	Perikaryon	IEA
GO:0044853	Component	Plasma membrane raft	ISS
GO:0045211	Component	Postsynaptic membrane	IBA	21873635
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045475	Process	Locomotor rhythm	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051260	Process	Protein homooligomerization	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0061337	Process	Cardiac conduction	TAS
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA	21873635
GO:0071805	Process	Potassium ion transmembrane transport	IDA	15454437, 24811166
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099060	Component	Integral component of postsynaptic specialization membrane	IEA
GO:1905030	Function	Voltage-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	21873635

Other IDs

• MIM: 605410
• HGNC: 6238
• e!Ensembl: ENSG00000184408

Protein

• UniProt ID: Q9NZV8
• Protein name: A-type voltage-gated potassium channel KCND2 (Potassium voltage-gated channel subfamily D member 2) (Voltage-gated potassium channel subunit Kv4.2)
• Protein function: Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Mediates the major part of the dendritic A-type current I(SA) in brain neurons (By similarity). This current is activ
• PDB: 7E7Z, 7E83, 7E84, 7E87, 7E8B, 7E8E, 7E8H, 7F0J, 7F3F, 7UK5, 7UKC, 7UKD, 7UKE, 7UKF, 7UKG, 7UKH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11601	Shal-type	3 → 31	Shal-type voltage-gated potassium channels, N-terminal	Domain
  PF02214	BTB_2	43 → 132	BTB/POZ domain	Domain
  PF00520	Ion_trans	184 → 417	Ion transport protein	Family
  PF11879	DUF3399	445 → 546	Domain of unknown function (DUF3399)	Family

• Sequence:

  MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
  RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
  FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT
  STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
  TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
  FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
  FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
  KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH
  LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
  PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
  PTPPVTTPEGDDRPESPEYSGGNIVRVSAL

• Sequence length: 630

Pathways

KEGG:

Serotonergic synapse

Reactome:

Voltage gated Potassium channels
Phase 1 - inactivation of fast Na+ channels

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	29581270
Epilepsy	Epilepsy	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	29581270