JAK2 (Janus kinase 2)

Gene

• Entrez ID: 3717
• Gene name: Janus kinase 2
• Gene symbol: JAK2
• Synonyms: JTK10
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: This gene encodes a non-receptor tyrosine kinase that plays a central role in cytokine and growth factor signalling. The primary isoform of this protein has an N-terminal FERM domain that is required for erythropoietin receptor association, an SH2 domain

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay, Western blot	19666866
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay	19666866
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blot	20548334
MIRT017973	hsa-miR-335-5p	Microarray	18185580
MIRT001749	hsa-miR-375	Reporter assay;Western blot	20548334
MIRT001749	hsa-miR-375	Reporter assay	15806104
MIRT051067	hsa-miR-16-5p	CLASH	23622248
MIRT044858	hsa-miR-195-5p	CLASH	23622248
MIRT000707	hsa-miR-135a-5p	qRT-PCR, Western blot	22310976
MIRT000707	hsa-miR-135a-5p	qRT-PCR, Western blot	22310976
MIRT001749	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24718681
MIRT001749	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24718681
MIRT001749	hsa-miR-375	Luciferase reporter assay, qRT-PCR	25055044
MIRT678309	hsa-miR-5692a	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT678309	hsa-miR-5692a	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT678309	hsa-miR-5692a	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT678308	hsa-miR-568	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT379479	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26498873
MIRT379479	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26498873
MIRT001749	hsa-miR-375	Western blot	28186962
MIRT001749	hsa-miR-375	Luciferase reporter assay	28006751
MIRT379479	hsa-miR-101-3p	Flow, qRT-PCR	27517565
MIRT678309	hsa-miR-5692a	HITS-CLIP	27418678
MIRT623561	hsa-miR-8485	HITS-CLIP	27418678
MIRT001749	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT001749	hsa-miR-375	Luciferase reporter assay, Western blotting, qRT-PCR	32045921
MIRT678309	hsa-miR-5692a	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	22927820
MIRT623561	hsa-miR-8485	HITS-CLIP	22927820
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT678309	hsa-miR-5692a	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT623561	hsa-miR-8485	HITS-CLIP	23313552
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT678309	hsa-miR-5692a	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT678308	hsa-miR-568	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT628089	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT623561	hsa-miR-8485	HITS-CLIP	23824327
MIRT000707	hsa-miR-135a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34176097
MIRT756314	rno-miR-21-5p	Western blotting	37641874
MIRT756359	hsa-miR-4429	Luciferase reporter assay, Western blotting, qRT-PCR	35722358
MIRT1076121	hsa-miR-106a	CLIP-seq
MIRT1076122	hsa-miR-106b	CLIP-seq
MIRT1076123	hsa-miR-1182	CLIP-seq
MIRT1076124	hsa-miR-1256	CLIP-seq
MIRT1076125	hsa-miR-1284	CLIP-seq
MIRT1076126	hsa-miR-1343	CLIP-seq
MIRT1076127	hsa-miR-17	CLIP-seq
MIRT1076128	hsa-miR-20a	CLIP-seq
MIRT1076129	hsa-miR-20b	CLIP-seq
MIRT1076130	hsa-miR-214	CLIP-seq
MIRT1076131	hsa-miR-23a	CLIP-seq
MIRT1076132	hsa-miR-23b	CLIP-seq
MIRT1076133	hsa-miR-23c	CLIP-seq
MIRT1076134	hsa-miR-2909	CLIP-seq
MIRT1076135	hsa-miR-300	CLIP-seq
MIRT1076136	hsa-miR-3143	CLIP-seq
MIRT1076137	hsa-miR-3145-3p	CLIP-seq
MIRT1076138	hsa-miR-3171	CLIP-seq
MIRT1076139	hsa-miR-337-3p	CLIP-seq
MIRT1076140	hsa-miR-338-5p	CLIP-seq
MIRT1076141	hsa-miR-34a	CLIP-seq
MIRT1076142	hsa-miR-34c-5p	CLIP-seq
MIRT1076143	hsa-miR-3609	CLIP-seq
MIRT1076144	hsa-miR-3619-5p	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT1076146	hsa-miR-3685	CLIP-seq
MIRT1076147	hsa-miR-381	CLIP-seq
MIRT1076148	hsa-miR-384	CLIP-seq
MIRT1076149	hsa-miR-4270	CLIP-seq
MIRT1076150	hsa-miR-4282	CLIP-seq
MIRT1076151	hsa-miR-4291	CLIP-seq
MIRT1076152	hsa-miR-4318	CLIP-seq
MIRT1076153	hsa-miR-433	CLIP-seq
MIRT1076154	hsa-miR-4426	CLIP-seq
MIRT1076155	hsa-miR-4441	CLIP-seq
MIRT1076156	hsa-miR-4468	CLIP-seq
MIRT1076157	hsa-miR-449a	CLIP-seq
MIRT1076158	hsa-miR-449b	CLIP-seq
MIRT1076159	hsa-miR-4509	CLIP-seq
MIRT1076160	hsa-miR-4536	CLIP-seq
MIRT1076161	hsa-miR-4647	CLIP-seq
MIRT1076162	hsa-miR-4660	CLIP-seq
MIRT1076163	hsa-miR-4662b	CLIP-seq
MIRT1076164	hsa-miR-4666-3p	CLIP-seq
MIRT1076165	hsa-miR-4678	CLIP-seq
MIRT1076166	hsa-miR-4720-5p	CLIP-seq
MIRT1076167	hsa-miR-4744	CLIP-seq
MIRT1076168	hsa-miR-4756-3p	CLIP-seq
MIRT1076169	hsa-miR-4778-5p	CLIP-seq
MIRT1076170	hsa-miR-4789-5p	CLIP-seq
MIRT1076171	hsa-miR-4795-3p	CLIP-seq
MIRT1076172	hsa-miR-4796-3p	CLIP-seq
MIRT1076173	hsa-miR-4799-3p	CLIP-seq
MIRT1076174	hsa-miR-495	CLIP-seq
MIRT1076175	hsa-miR-5096	CLIP-seq
MIRT1076176	hsa-miR-513a-3p	CLIP-seq
MIRT1076177	hsa-miR-518a-5p	CLIP-seq
MIRT1076178	hsa-miR-519d	CLIP-seq
MIRT1076179	hsa-miR-527	CLIP-seq
MIRT1076180	hsa-miR-543	CLIP-seq
MIRT1076181	hsa-miR-548a-3p	CLIP-seq
MIRT1076182	hsa-miR-548ac	CLIP-seq
MIRT1076183	hsa-miR-548ae	CLIP-seq
MIRT1076184	hsa-miR-548ah	CLIP-seq
MIRT1076185	hsa-miR-548aj	CLIP-seq
MIRT1076186	hsa-miR-548am	CLIP-seq
MIRT1076187	hsa-miR-548d-3p	CLIP-seq
MIRT1076188	hsa-miR-548e	CLIP-seq
MIRT1076189	hsa-miR-548f	CLIP-seq
MIRT1076190	hsa-miR-548x	CLIP-seq
MIRT1076191	hsa-miR-548z	CLIP-seq
MIRT1076192	hsa-miR-605	CLIP-seq
MIRT1076193	hsa-miR-610	CLIP-seq
MIRT1076194	hsa-miR-646	CLIP-seq
MIRT1076195	hsa-miR-761	CLIP-seq
MIRT1076196	hsa-miR-922	CLIP-seq
MIRT1076197	hsa-miR-93	CLIP-seq
MIRT1076125	hsa-miR-1284	CLIP-seq
MIRT2018949	hsa-miR-3120-3p	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2018953	hsa-miR-4698	CLIP-seq
MIRT1076170	hsa-miR-4789-5p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018957	hsa-miR-579	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq
MIRT2018959	hsa-miR-607	CLIP-seq
MIRT2250778	hsa-miR-370	CLIP-seq
MIRT2250779	hsa-miR-4325	CLIP-seq
MIRT2018953	hsa-miR-4698	CLIP-seq
MIRT2250780	hsa-miR-4793-3p	CLIP-seq
MIRT2250781	hsa-miR-556-5p	CLIP-seq
MIRT2018957	hsa-miR-579	CLIP-seq
MIRT2018959	hsa-miR-607	CLIP-seq
MIRT1076193	hsa-miR-610	CLIP-seq
MIRT2554255	hsa-miR-362-5p	CLIP-seq
MIRT2554256	hsa-miR-3653	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2554257	hsa-miR-500b	CLIP-seq
MIRT2554258	hsa-miR-502-5p	CLIP-seq
MIRT2554259	hsa-miR-511	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq
MIRT2554255	hsa-miR-362-5p	CLIP-seq
MIRT2554256	hsa-miR-3653	CLIP-seq
MIRT1076145	hsa-miR-3658	CLIP-seq
MIRT2683087	hsa-miR-4456	CLIP-seq
MIRT2018950	hsa-miR-4521	CLIP-seq
MIRT2018951	hsa-miR-4639-5p	CLIP-seq
MIRT2018952	hsa-miR-4668-3p	CLIP-seq
MIRT2683088	hsa-miR-4757-5p	CLIP-seq
MIRT2018954	hsa-miR-500a	CLIP-seq
MIRT2554257	hsa-miR-500b	CLIP-seq
MIRT2554258	hsa-miR-502-5p	CLIP-seq
MIRT2554259	hsa-miR-511	CLIP-seq
MIRT2018955	hsa-miR-520d-5p	CLIP-seq
MIRT2018956	hsa-miR-524-5p	CLIP-seq
MIRT2018958	hsa-miR-600	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Unknown	11163768
ESR1	Unknown	19876927
STAT1	Activation	21239533
STAT3	Activation	17151100
STAT3	Unknown	19783654

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000186	Process	Activation of MAPKK activity	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0001774	Process	Microglial cell activation	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0004672	Function	Protein kinase activity	TAS
GO:0004713	Function	Protein tyrosine kinase activity	EXP	9111318, 15143187, 19665053, 20304997
GO:0004713	Function	Protein tyrosine kinase activity	IDA	23061660
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	11201744
GO:0005131	Function	Growth hormone receptor binding	IBA	21873635
GO:0005131	Function	Growth hormone receptor binding	ISS
GO:0005143	Function	Interleukin-12 receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	9516124, 11679576, 11694501, 11970898, 15821101, 16437163, 17474147, 18692472, 19234114, 20353823, 21806020, 24931576, 25092874, 26175413, 30413785
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10502458, 19783980
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	10502458
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005901	Component	Caveola	ISS
GO:0005925	Component	Focal adhesion	IDA
GO:0006468	Process	Protein phosphorylation	TAS	9670957
GO:0006915	Process	Apoptotic process	ISS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS
GO:0007165	Process	Signal transduction	ISS
GO:0007167	Process	Enzyme linked receptor protein signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	ISS
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	ISS
GO:0007498	Process	Mesoderm development	TAS	9590174
GO:0007596	Process	Blood coagulation	TAS
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IDA	10925297
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	8609418
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IDA	10925297
GO:0020037	Function	Heme binding	IDA	21036157
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030041	Process	Actin filament polymerization	NAS	10925297
GO:0030154	Process	Cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031702	Function	Type 1 angiotensin receptor binding	IEA
GO:0031904	Component	Endosome lumen	TAS
GO:0031959	Process	Mineralocorticoid receptor signaling pathway	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032516	Process	Positive regulation of phosphoprotein phosphatase activity	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0033130	Function	Acetylcholine receptor binding	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	8609418
GO:0034612	Process	Response to tumor necrosis factor	IDA	8609418
GO:0035401	Function	Histone kinase activity (H3-Y41 specific)	IBA	21873635
GO:0035401	Function	Histone kinase activity (H3-Y41 specific)	IDA	19783980
GO:0035409	Process	Histone H3-Y41 phosphorylation	IBA	21873635
GO:0035409	Process	Histone H3-Y41 phosphorylation	IDA	19783980
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042169	Function	SH2 domain binding	IPI	9727029
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042393	Function	Histone binding	IDA	19783980
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0042802	Function	Identical protein binding	IPI	21841788, 22820988
GO:0042976	Process	Activation of Janus kinase activity	ISS
GO:0042981	Process	Regulation of apoptotic process	IBA	21873635
GO:0043388	Process	Positive regulation of DNA binding	IEA
GO:0043392	Process	Negative regulation of DNA binding	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0043560	Function	Insulin receptor substrate binding	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	ISS
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045822	Process	Negative regulation of heart contraction	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046579	Process	Positive regulation of Ras protein signal transduction	TAS
GO:0046677	Process	Response to antibiotic	IDA	16280321
GO:0046777	Process	Protein autophosphorylation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	10925297
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050867	Process	Positive regulation of cell activation	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IGI	28334068
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	ISS
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS
GO:0060399	Process	Positive regulation of growth hormone receptor signaling pathway	ISS
GO:0061180	Process	Mammary gland epithelium development	ISS
GO:0070102	Process	Interleukin-6-mediated signaling pathway	TAS
GO:0070106	Process	Interleukin-27-mediated signaling pathway	TAS
GO:0070671	Process	Response to interleukin-12	IDA	7528775
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0097296	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	ISS
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26515423
GO:1902728	Process	Positive regulation of growth factor dependent skeletal muscle satellite cell proliferation	IEA
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:2000273	Process	Positive regulation of signaling receptor activity	ISS

Other IDs

• MIM: 147796
• HGNC: 6192
• e!Ensembl: ENSG00000096968

Protein

• UniProt ID: O60674
• Protein name: Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2)
• Protein function: Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal ro
• PDB: 2B7A, 2W1I, 2XA4, 3E62, 3E63, 3E64, 3FUP, 3IO7, 3IOK, 3JY9, 3KCK, 3KRR, 3LPB, 3Q32, 3RVG, 3TJC, 3TJD, 3UGC, 3ZMM, 4AQC, 4BBE, 4BBF, 4C61, 4C62, 4D0W, 4D0X, 4D1S, 4E4M, 4E6D, 4E6Q, 4F08, 4F09, 4FVP, 4FVQ, 4FVR, 4GFM, 4GMY, 4HGE, 4IVA, 4JI9, 4JIA, 4P7E, 4YTC, 4YTF, 4YTH, 4YTI, 4Z32, 4ZIM, 5AEP, 5CF4, 5CF5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18379	FERM_F1	39 → 134	FERM F1 ubiquitin-like domain	Domain
  PF18377	FERM_F2	142 → 261	FERM F2 acyl-CoA binding protein-like domain	Domain
  PF17887	Jak1_Phl	299 → 381	Jak1 pleckstrin homology-like domain	Domain
  PF00017	SH2	400 → 481	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	545 → 805	Protein tyrosine and serine/threonine kinase	Domain
  PF07714	PK_Tyr_Ser-Thr	849 → 1123	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
  EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
  PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
  MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
  SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
  GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
  EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
  GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
  YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
  RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
  MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
  MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
  PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
  ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
  PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
  ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
  CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
  YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
  LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

• Sequence length: 1132

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Chemokine signaling pathway
Hormone signaling
Efferocytosis
PI3K-Akt signaling pathway
Necroptosis
Signaling pathways regulating pluripotency of stem cells
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Cholinergic synapse
Prolactin signaling pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Leishmaniasis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Reactome:

Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
Prolactin receptor signaling
Signaling by SCF-KIT
RMTs methylate histone arginines
Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF activation
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
IL-6-type cytokine receptor ligand interactions
Signaling by moderate kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Cyclin D associated events in G1
Interferon gamma signaling
Regulation of IFNG signaling
Interleukin-20 family signaling
Interleukin-35 Signalling
Interleukin-12 signaling
Interleukin-23 signaling
Interleukin-27 signaling
Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
Erythropoietin activates RAS
Interleukin receptor SHC signaling
Signaling downstream of RAS mutants
Growth hormone receptor signaling
Factors involved in megakaryocyte development and platelet production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	27470402
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291
Erythrocytosis	Erythrocytosis familial, 1	rs119476044, rs119476045, rs137853036, rs137853037, rs35020585, rs33949869, rs33987903, rs36020563, rs35890959, rs1141387, rs35117167, rs33969677, rs33918338, rs33951978, rs33954595, rs33945777, rs35724775, rs35004220, rs34690599, rs33978134, rs1554393463, rs1554393458, rs1018129986, rs1596573335
Hemangioma	Hemangioma	rs119475040, rs121917766
Hypertension	Hypertensive disease	rs13306026, rs13333226
Leukemia	leukemia, Leukemia, Myelocytic, Acute, Acute leukemia, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	19636672, 16247455, 21689158, 22571758, 22829971, 20631743, 22422826, 24404189, 23115274, 22818858, 21120162, 20339092, 22041374, 16247455
Liver failure	Liver Failure, Acute	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682
Lymphoblastic leukemia	Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591
Myelodysplasia	Myelodysplasia	rs141601766, rs1261178797
Myelodysplastic syndrome	MYELODYSPLASTIC SYNDROME	rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Myelofibrosis	Myelofibrosis, Primary Myelofibrosis	rs77375493, rs587776885, rs1555760738, rs146249964, rs755257605	25157968, 19636672, 19287384, 19287382, 21942426, 15858187, 19287385, 24986690, 19154659, 16293597, 15781101, 16951397
Myeloproliferative disorder	Myeloproliferative disease	rs267606708, rs77375493	22087750, 17267906, 19287384, 25849990, 29047144, 20585391, 15781101
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693
Pancytopenia	Pancytopenia	rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820
Polycythemia vera	Polycythemia Vera	rs77375493	19287384, 16603627, 15781101, 20160369, 15793561, 16484586, 17267906, 19154659, 15858187, 21942426, 19287382, 18717827
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17199135
Pulmonary arterial hypertension	Pulmonary arterial hypertension, Idiopathic pulmonary arterial hypertension	rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424, rs863223408, rs869025366, rs876657748, rs886039506, rs886041324, rs1060502576, rs1060502581, rs1060502584, rs1085307149, rs1085307154, rs1085307157, rs1085307163, rs1085307169, rs1085307177, rs1085307180, rs1085307184, rs1085307188, rs1085307191, rs1085307203, rs1085307222, rs1085307223, rs1085307225, rs1085307229, rs1085307234, rs1085307246, rs1085307261, rs1085307267, rs576091247, rs200948870, rs1085307278, rs1085307282, rs1085307285, rs1085307290, rs1085307301, rs1085307306, rs1085307307, rs1085307308, rs1085307315, rs1085307316, rs1553509997, rs1085307324, rs1085307340, rs1085307349, rs1085307352, rs765887545, rs1085307183, rs1555208696, rs1592224412, rs1574415785, rs1574415799, rs1574462520, rs1085307197, rs1574464060, rs749485755, rs1574464121, rs1574464150, rs1574464160, rs1085307214, rs1574485996, rs1574486497, rs1574486566, rs1574488314, rs1574488346, rs1574488353, rs1574488357, rs1574488412, rs1414031345, rs1574488484, rs1574488490, rs863223419, rs1574489046, rs1574494632, rs1574494655, rs1574500018, rs1574505253, rs1574505321, rs371174955, rs1574506729, rs1574506732, rs1574506781, rs1574506790, rs1574506799, rs1574506914, rs1574506976, rs1574507076, rs1574507124, rs1574507215, rs1574507268, rs1574507272, rs1574507276, rs1574507290, rs1574507331, rs398123042, rs374644720, rs1588573831, rs1592222308, rs1592223392, rs756315327, rs1603248167, rs1397811125, rs1603255267, rs1603255327, rs1603255336, rs1603255339, rs754897911, rs1603256095, rs1085307155, rs1085307156, rs1574464226, rs1085307226, rs1574486038, rs1553508321, rs1574488277, rs1574488501, rs1574493841, rs1574499954
Thrombocythemia	Essential thrombocythemia, THROMBOCYTHEMIA 3, Thrombocythemia, Essential	rs2108623965, rs771269271, rs121913614, rs77375493, rs1555760738, rs750046020, rs148434485, rs1714397896	16325696, 22397670, 16896569, 15781101, 21942426, 21653328, 16484586, 19154659, 15858187, 20434300, 21825979, 19636672
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841, rs1555096583, rs1220533001, rs762936774, rs775341386	21335463

Unknown
Disease name	Disease term	dbSNP ID	References
Anorexia	Anorexia
B-cell lymphoma	Adult Diffuse Large B-Cell Lymphoma
Budd-chiari syndrome	Budd-Chiari Syndrome	rs6025, rs9332701, rs6009, rs369516642, rs9332607, rs9287090, rs1046712, rs1800594, rs6032, rs4525, rs6018, rs6031, rs6021, rs6024, rs6017, rs6016, rs6037, rs6036, rs6015, rs6033, rs9332578, rs6023, rs6022, rs6029, rs6019, rs6028, rs2187952, rs75764442, rs9332678, rs191866237, rs9332673, rs188490117, rs886045539, rs886045540, rs773618429, rs886045543, rs148772659, rs200865371, rs149092241, rs6026, rs6011, rs144262027, rs13306334, rs139573207, rs13306332, rs369276714, rs6005, rs144979314, rs201078171, rs758832130, rs748350385, rs148752831, rs143152035, rs145625079, rs886045534, rs72708013, rs886045536, rs544753372, rs72708017, rs886045537, rs181328696, rs186962725, rs757104503, rs35369423, rs759428783, rs6008, rs199568344, rs141589936, rs751749207, rs886045547, rs149048805, rs886045548, rs149067268, rs199507543, rs9332695, rs370739570, rs375739973, rs537081933, rs9332485, rs41272465, rs886045552, rs9332677, rs9332675, rs376103455, rs6427196, rs886045535, rs559071301, rs753366128, rs9332676, rs2040444, rs9332674, rs886045538, rs534748300, rs180742904, rs115882472, rs886045541, rs372005449, rs182566496, rs886045542, rs374815777, rs886045544, rs886045545, rs6010, rs886045546, rs763080313, rs200204656, rs559683767, rs543751483, rs373880789, rs6006, rs41272457, rs115148599, rs9332608, rs188882337, rs886045549, rs146408488, rs575766548, rs776949074, rs141768227, rs9332604, rs886045550, rs574610215, rs1557573, rs201510575, rs112333778, rs886045551, rs6020, rs781434840, rs200934105, rs116416322, rs543172813, rs529050943, rs1057515594, rs1038207109, rs1057515590, rs1057515597, rs139964957, rs1057515601, rs143509841, rs41272455, rs373172802, rs6007, rs6034, rs150104888, rs747456938, rs185294741	16762626, 19293426, 23425079, 26557140, 25698270, 18600100, 23980667
Cardiac valvular disease	Heart valve disease		21335463
Uterine cervix neoplasm	Uterine Cervical Neoplasm		27470402
Cholecystitis	Cholecystitis
Cirrhosis	Cirrhosis	rs119465999, rs144369314, rs8056684, rs112053857, rs75998507
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	18587394
Dysarthria	Dysarthria
Esophageal varix	Esophageal Varices
Hematologic neoplasms	Hematologic Neoplasms
Hepatic vein thrombosis	Hepatic Vein Thrombosis		26557140, 16762626, 19293426
Intestinal obstruction	Intestinal Obstruction
Liver carcinoma	Liver carcinoma
Lupus erythematosus	Lupus Erythematosus, Systemic		27399966
Lymphoblastic leukemia with lymphomatous features	Acute lymphoblastic leukemia with lymphomatous features		22955920, 22368270, 18805579, 19470474
Malabsorption syndrome	Malabsorption Syndrome
Mesenteric vascular occlusion	Mesenteric Vascular Occlusion		20434300
Miscarriage	Miscarriage		17989398
Myeloid leukemia	Myeloid Leukemia, Chronic, Acute Myeloid Leukemia, M1		16247455
Myocardial ischemia	Myocardial Ischemia		15746188, 16214533
Non-alcoholic fatty liver disease	Non-alcoholic Fatty Liver Disease, Nonalcoholic Steatohepatitis		28100771
Ovarian serous adenocarcinoma	Ovarian Serous Adenocarcinoma
Peripheral arterial stenosis	Peripheral arterial stenosis
Polycythemia	Polycythemia		17267906
Portal hypertension	Portal Hypertension
Portal vein thrombosis	Portal Vein Thrombosis
Prostatic neoplasms	Prostatic Neoplasms		17199135
Stroke	Cerebrovascular accident
Thrombocytosis	Familial thrombocytosis, Thrombocytosis, Thrombocytosis, Autosomal Dominant		22397670, 19287382, 19287384, 21942426, 20434300, 16896569, 15858187, 19636672, 19154659, 15781101, 16484586
Thrombosis	Deep Vein Thrombosis		20434300
Transient ischemic attack	Transient Ischemic Attack
Ulcerative colitis	Ulcerative Colitis		20228799, 21297633