ITIH4 (inter-alpha-trypsin inhibitor heavy chain 4)

Gene

• Entrez ID: 3700
• Gene name: Inter-alpha-trypsin inhibitor heavy chain 4
• Gene symbol: ITIH4
• Synonyms: GP120, H4P, IHRP, ITI-HC4, ITIHL1, PK-120, PK120
• Chromosome: 3
• Chromosome location: 3p21.1
• Summary: The protein encoded by this gene is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be upregulated during surgical trauma. This gene is part

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019901	hsa-miR-375	Microarray	20215506
MIRT1074360	hsa-miR-1269	CLIP-seq
MIRT1074361	hsa-miR-1269b	CLIP-seq
MIRT1074362	hsa-miR-1288	CLIP-seq
MIRT1074363	hsa-miR-3179	CLIP-seq
MIRT1074364	hsa-miR-3646	CLIP-seq
MIRT1074365	hsa-miR-3652	CLIP-seq
MIRT1074366	hsa-miR-3662	CLIP-seq
MIRT1074367	hsa-miR-378	CLIP-seq
MIRT1074368	hsa-miR-378b	CLIP-seq
MIRT1074369	hsa-miR-378c	CLIP-seq
MIRT1074370	hsa-miR-378d	CLIP-seq
MIRT1074371	hsa-miR-378e	CLIP-seq
MIRT1074372	hsa-miR-378f	CLIP-seq
MIRT1074373	hsa-miR-378h	CLIP-seq
MIRT1074374	hsa-miR-378i	CLIP-seq
MIRT1074375	hsa-miR-422a	CLIP-seq
MIRT1074376	hsa-miR-4430	CLIP-seq
MIRT1074377	hsa-miR-4492	CLIP-seq
MIRT1074378	hsa-miR-4498	CLIP-seq
MIRT1074379	hsa-miR-4515	CLIP-seq
MIRT1074380	hsa-miR-4740-5p	CLIP-seq
MIRT1074381	hsa-miR-4766-5p	CLIP-seq
MIRT1074382	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002576	Process	Platelet degranulation	TAS
GO:0004866	Function	Endopeptidase inhibitor activity	TAS	9756925
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	16271702
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0006953	Process	Acute-phase response	IEP	19263524
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0030212	Process	Hyaluronan metabolic process	IEA
GO:0031089	Component	Platelet dense granule lumen	TAS
GO:0034097	Process	Response to cytokine	IEP	10486281
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 28675934
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 600564
• HGNC: 6169
• e!Ensembl: ENSG00000055955

Protein

• UniProt ID: Q14624
• Protein name: Inter-alpha-trypsin inhibitor heavy chain H4 (ITI heavy chain H4) (ITI-HC4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (Gp120) (PK-120) [Cl
• Protein function: Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
• PDB: 9C4F, 9C4N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08487	VIT	35 → 146	Vault protein inter-alpha-trypsin domain	Family
  PF00092	VWA	274 → 456	von Willebrand factor type A domain	Domain
  PF06668	ITI_HC_C	766 → 930	Inter-alpha-trypsin inhibitor heavy chain C-terminus	Family

• Sequence:

  MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNR
  ANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKA
  TGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFE
  PQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIR
  YDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVIDKSGSMSGRKIQQTREALIKI
  LDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGTNINDAMLMAV
  QLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQNNVREAVSGRYSLFCLGFGFD
  VSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQN
  NFRLLFKGSEMVVAGKLQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIF
  HNFMERLWAYLTIQQLLEQTVSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQE
  QSQVAEKPMEGESRNRNVHSGSTFFKYYLQGAKIPKPEASFSPRRGWNRQAGAAGSRMNF
  RPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETT
  MTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGF
  SWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDP
  DKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQ
  GNDHSATRERRLDYQEGPPGVEISCWSVEL

• Sequence length: 930

Pathways

Reactome:

Platelet degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	25200834
Multiple polyposis syndrome	Adenomatous Polyposis Coli, Polyposis, Adenomatous Intestinal, Familial Intestinal Polyposis	rs137854568, rs137854569, rs387906231, rs137854574, rs137854575, rs387906234, rs587776520, rs1801155, rs387906236, rs137854580, rs387906239, rs397515732, rs397515733, rs397515734, rs397515735, rs587779352, rs587779353, rs398123118, rs587779780, rs587779783, rs587779794, rs62619935, rs587781330, rs587781392, rs587781694, rs587782557, rs587783035, rs727504420, rs376213437, rs730882135, rs786201291, rs786201856, rs775126020, rs768922431, rs121913332, rs863225362, rs863225365, rs863225371, rs863225319, rs863225347, rs756912930, rs876659517, rs754122018, rs876659280, rs121913331, rs758987855, rs863224281, rs879254032, rs879254283, rs886039507, rs1060503323, rs1060503366, rs1064793020, rs1064793535, rs1114167545, rs1114167551, rs1114167571, rs1554071602, rs1554072560, rs1554074738, rs1554079988, rs1554081906, rs1554084508, rs1554085102, rs1554085307, rs1554085382, rs1554085817, rs1060503288, rs1392778905, rs1554086084, rs1554086134, rs1554086138, rs1554087515, rs774847203, rs1554084454, rs1114167599, rs1554086340, rs1554084403, rs1554085084, rs777848503, rs1554086262, rs1554083981, rs1554084650, rs1064794163, rs1554086923, rs1554086823, rs1554085303, rs1554084159, rs1554081749, rs1554084512, rs1561576666, rs1561545947, rs1561588017, rs1561589459, rs1561598017, rs1561569606, rs1580685528, rs1580634573, rs1580649018, rs1561597691, rs79630786	25200834
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21926974

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		21926972, 21926974, 25136889
Depressed bipolar disorder	Depressed bipolar I disorder		31043756