ITGB7 (integrin subunit beta 7)

Gene

• Entrez ID: 3695
• Gene name: Integrin subunit beta 7
• Gene symbol: ITGB7
• Synonyms: -
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1074228	hsa-miR-1262	CLIP-seq
MIRT1074229	hsa-miR-3646	CLIP-seq
MIRT1074230	hsa-miR-3647-3p	CLIP-seq
MIRT1074231	hsa-miR-3662	CLIP-seq
MIRT1074232	hsa-miR-4455	CLIP-seq
MIRT1074233	hsa-miR-4639-3p	CLIP-seq
MIRT1074234	hsa-miR-4701-3p	CLIP-seq
MIRT1074235	hsa-miR-4714-5p	CLIP-seq
MIRT1074236	hsa-miR-4766-5p	CLIP-seq
MIRT1074237	hsa-miR-597	CLIP-seq
MIRT1074238	hsa-miR-609	CLIP-seq
MIRT1074239	hsa-miR-635	CLIP-seq
MIRT1074240	hsa-miR-668	CLIP-seq
MIRT2250212	hsa-miR-1293	CLIP-seq
MIRT2250213	hsa-miR-4483	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MAF	Activation	17490615

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0003366	Process	Cell-matrix adhesion involved in ameboidal cell migration	IMP	23986478
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	1542691, 14681217, 17690686, 19828450, 21524097, 22232704
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0007155	Process	Cell adhesion	TAS	2040616
GO:0007160	Process	Cell-matrix adhesion	IBA	21873635
GO:0007160	Process	Cell-matrix adhesion	IMP	18308860, 23986478
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	23986478
GO:0008305	Component	Integrin complex	IBA	21873635
GO:0008305	Component	Integrin complex	TAS	2040616
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	18308860, 23986478
GO:0016020	Component	Membrane	HDA	19946888
GO:0016477	Process	Cell migration	IBA	21873635
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0033627	Process	Cell adhesion mediated by integrin	IBA	21873635
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	18308860
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	23986478
GO:0034669	Component	Integrin alpha4-beta7 complex	IDA	18308860, 23986478
GO:0038023	Function	Signaling receptor activity	IEA
GO:0043113	Process	Receptor clustering	IMP	23986478
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0046718	Process	Viral entry into host cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050776	Process	Regulation of immune response	TAS
GO:0050839	Function	Cell adhesion molecule binding	IMP	23986478
GO:0050901	Process	Leukocyte tethering or rolling	IMP	18308860
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0072678	Process	T cell migration	IEA

Other IDs

• MIM: 147559
• HGNC: 6162
• e!Ensembl: ENSG00000139626

Protein

• UniProt ID: P26010
• Protein name: Integrin beta-7 (Gut homing receptor beta subunit)
• Protein function: Integrin ITGA4/ITGB7 (alpha-4/beta-7) (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT) (Probable). Integrin ITGA4/ITGB7 interacts with
• PDB: 2BRQ, 3V4P, 3V4V, 8ZJF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17205	PSI_integrin	43 → 92	Integrin plexin domain	Domain
  PF00362	Integrin_beta	147 → 393	Integrin beta chain VWA domain	Domain
  PF07974	EGF_2	605 → 635	EGF-like domain	Domain
  PF08725	Integrin_b_cyt	747 → 791	Integrin beta cytoplasmic domain	Domain

• Sequence:

  MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
  CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
  TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
  RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
  AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
  GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
  KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
  KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
  TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
  GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
  DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
  PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
  ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
  AITTTINPRFQEADSPTL

• Sequence length: 798

Pathways

KEGG:

PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Human papillomavirus infection
Transcriptional misregulation in cancer
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Prostate cancer	Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27515689