IRS1 (insulin receptor substrate 1)

Gene

• Entrez ID: 3667
• Gene name: Insulin receptor substrate 1
• Gene symbol: IRS1
• Synonyms: HIRS-1
• Chromosome: 2
• Chromosome location: 2q36.3
• Summary: This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance. [provided by RefSeq, Nov 2009]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801278	C>G,T	Risk-factor	Coding sequence variant, missense variant
rs104893642	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs1259467443	ACC>-	Pathogenic	Coding sequence variant, inframe deletion

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000731	hsa-miR-145-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot, Reporter assay;Other	17827156
MIRT000731	hsa-miR-145-5p	qRT-PCR, Western blot	19391107
MIRT000731	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT000731	hsa-miR-145-5p	Luciferase reporter assay, Western blot	23201159
MIRT000731	hsa-miR-145-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24690171
MIRT000731	hsa-miR-145-5p	qRT-PCR, Western blot	19439999
MIRT000731	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23714355
MIRT000731	hsa-miR-145-5p	qRT-PCR, In situ hybridization, Western blot	25477374
MIRT003807	hsa-miR-7-5p	Western blot	18483236
MIRT004355	hsa-miR-126-3p	qRT-PCR, Luciferase reporter assay, Western blot	18834857
MIRT004355	hsa-miR-126-3p	Luciferase reporter assay	21464990
MIRT004355	hsa-miR-126-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23603512
MIRT004355	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23893300
MIRT004355	hsa-miR-126-3p	Luciferase reporter assay	26893711
MIRT004355	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	26617742
MIRT004355	hsa-miR-126-3p	Microarray, qRT-PCR, Western blot	27119351
MIRT006859	hsa-miR-148a-3p	Luciferase reporter assay, Western blot	22935141
MIRT006860	hsa-miR-152-3p	Luciferase reporter assay, Western blot	22935141
MIRT437910	hsa-miR-105-5p	Luciferase reporter assay, Western blot	25280563
MIRT442208	hsa-miR-4480	PAR-CLIP	22100165
MIRT442210	hsa-miR-4311	PAR-CLIP	22100165
MIRT542213	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT542213	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542214	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT542214	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT542214	hsa-miR-4789-5p	HITS-CLIP	27418678
MIRT542215	hsa-miR-3941	PAR-CLIP	21572407
MIRT542215	hsa-miR-3941	HITS-CLIP	24906430
MIRT542215	hsa-miR-3941	HITS-CLIP	23824327
MIRT542215	hsa-miR-3941	HITS-CLIP	27418678
MIRT542216	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT542216	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT542217	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT542217	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT542218	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT542218	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT542218	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT542219	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT542219	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT542219	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT542220	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT542220	hsa-miR-5580-3p	HITS-CLIP	23824327
MIRT542221	hsa-miR-603	PAR-CLIP	21572407
MIRT542221	hsa-miR-603	HITS-CLIP	24906430
MIRT542221	hsa-miR-603	HITS-CLIP	23824327
MIRT542221	hsa-miR-603	HITS-CLIP	27418678
MIRT542222	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT542222	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT542222	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT542222	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT542223	hsa-miR-8485	PAR-CLIP	21572407
MIRT542223	hsa-miR-8485	HITS-CLIP	24906430
MIRT542223	hsa-miR-8485	HITS-CLIP	23824327
MIRT542223	hsa-miR-8485	HITS-CLIP	27418678
MIRT542224	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT542224	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT542224	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT542224	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT544956	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544956	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT544956	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT556913	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT623572	hsa-miR-1185-2-3p	HITS-CLIP	23824327
MIRT623572	hsa-miR-1185-2-3p	HITS-CLIP	27418678
MIRT623573	hsa-miR-1185-1-3p	HITS-CLIP	23824327
MIRT623573	hsa-miR-1185-1-3p	HITS-CLIP	27418678
MIRT623574	hsa-let-7f-2-3p	HITS-CLIP	23824327
MIRT623574	hsa-let-7f-2-3p	HITS-CLIP	27418678
MIRT623575	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT623576	hsa-miR-4310	HITS-CLIP	23824327
MIRT623577	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT667814	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT711049	hsa-miR-892c-3p	HITS-CLIP	19536157
MIRT711050	hsa-miR-4676-3p	HITS-CLIP	19536157
MIRT711051	hsa-miR-452-5p	HITS-CLIP	19536157
MIRT711052	hsa-miR-429	HITS-CLIP	19536157
MIRT711053	hsa-miR-200c-3p	HITS-CLIP	19536157
MIRT711054	hsa-miR-200b-3p	HITS-CLIP	19536157
MIRT732116	hsa-miR-1225-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26684358
MIRT734527	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27069535
MIRT735025	hsa-miR-628-5p	Luciferase reporter assay	27766036
MIRT735485	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27542674

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	ISS
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005158	Function	Insulin receptor binding	IBA	21873635
GO:0005158	Function	Insulin receptor binding	IPI	7493946, 7537849
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	7541045
GO:0005515	Function	Protein binding	IPI	7513703, 7542742, 7559478, 7680095, 7680644, 7935368, 8382612, 8388384, 9295312, 11018022, 11403293, 11416002, 11694516, 14632132, 16230374, 16273093, 16582879, 18498745, 18952604, 23643389, 23770097, 24008843, 25814554
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005899	Component	Insulin receptor complex	ISS
GO:0005901	Component	Caveola	IDA	15182363
GO:0007165	Process	Signal transduction	TAS	1311924
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	17925406
GO:0008286	Process	Insulin receptor signaling pathway	IBA	21873635
GO:0008286	Process	Insulin receptor signaling pathway	IDA	16516141, 23401856
GO:0008286	Process	Insulin receptor signaling pathway	IMP	16814735
GO:0008286	Process	Insulin receptor signaling pathway	IPI	7537849, 7559478
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0014065	Process	Phosphatidylinositol 3-kinase signaling	IDA	7782332
GO:0030159	Function	Signaling receptor complex adaptor activity	IDA	7493946
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032868	Process	Response to insulin	IDA	16516141
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0042169	Function	SH2 domain binding	ISS
GO:0042593	Process	Glucose homeostasis	TAS	16814735
GO:0043231	Component	Intracellular membrane-bounded organelle	ISS
GO:0043434	Process	Response to peptide hormone	ISS
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA	21873635
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	7782332, 16043515
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	ISS
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	ISS
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0046326	Process	Positive regulation of glucose import	IDA	7493946
GO:0046326	Process	Positive regulation of glucose import	IMP	16814735
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	7493946
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	ISS
GO:0046676	Process	Negative regulation of insulin secretion	IDA	15572028
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IPI	7541045
GO:0048015	Process	Phosphatidylinositol-mediated signaling	TAS
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0071398	Process	Cellular response to fatty acid	ISS

Other IDs

• MIM: 147545
• HGNC: 6125
• e!Ensembl: ENSG00000169047

Protein

• UniProt ID: P35568
• Protein name: Insulin receptor substrate 1 (IRS-1)
• Protein function: May mediate the control of various cellular processes by insulin. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains such as phosphatidylinositol 3-kinase p85 subunit or GRB2. Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit (By similarity).
• PDB: 1IRS, 1K3A, 1QQG, 2Z8C, 5U1M, 6BNT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	7 → 114	PH domain	Domain
  PF02174	IRS	160 → 262	PTB domain (IRS-1 type)	Domain

• Sequence:

  MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
  KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
  HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
  GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
  DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
  RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
  GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
  SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
  GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
  SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHR
  PDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
  GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVES
  SGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEP
  EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
  LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE
  FGSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGV
  EMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIA
  AEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPN
  RNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKR
  HSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
  PPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ

• Sequence length: 1242

Pathways

KEGG:

cGMP-PKG signaling pathway
FoxO signaling pathway
Hormone signaling
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Neurotrophin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
Growth hormone synthesis, secretion and action
Aldosterone-regulated sodium reabsorption
Alzheimer disease
MicroRNAs in cancer
Diabetic cardiomyopathy

Reactome:

PI3K Cascade
IRS-mediated signalling
SOS-mediated signalling
PIP3 activates AKT signaling
Interleukin-7 signaling
PI3K/AKT activation
Constitutive Signaling by Aberrant PI3K in Cancer
IRS-related events triggered by IGF1R
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
IRS activation
Signal attenuation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs-1, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	10591678, 10430617, 12843189, 8723689, 19734900, 15688983, 10206679, 12679424, 28869590, 8104271
Hyperlipidemia	Hyperlipidemia	rs118204057, rs118204060, rs118204062, rs1563569634, rs118204069, rs118204070, rs118204071, rs3737787, rs2073658, rs1566946168, rs1064797075	10591678
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	10591678
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs-1, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	23954404
Coronary heart disease	Coronary heart disease	rs-1	28869590
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	15678496
Carcinoma of the head and neck	Squamous cell carcinoma of the head and neck	rs-1, rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001, rs786201838, rs587782144, rs866775781, rs730882008, rs1567549584, rs1597371666, rs1597365075	30594912
Hyperinsulinism	Hyperinsulinism	rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs-1, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209, rs761749884, rs797045624, rs863225280, rs139964066, rs1057516281, rs1057516317, rs576684889, rs201682634, rs1350717554, rs768951263, rs1260178539, rs200670692, rs72559734, rs1400535021, rs372307320, rs1554923999, rs751279984, rs1008906426, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1599937180	19734900

Unknown
Disease name	Disease term	dbSNP ID	References
Compensatory hyperinsulinemia	Compensatory Hyperinsulinemia		19734900
Coronary arteriosclerosis	Coronary Arteriosclerosis		10591678
Endogenous hyperinsulinism	Endogenous Hyperinsulinism		19734900
Exogenous hyperinsulinism	Exogenous Hyperinsulinism		19734900
Liver carcinoma	Liver carcinoma		23958494, 1311924
Prostatic neoplasms	Prostatic Neoplasms		15678496