INSM1 (INSM transcriptional repressor 1)

Gene

• Entrez ID: 3642
• Gene name: INSM transcriptional repressor 1
• Gene symbol: INSM1
• Synonyms: IA-1, IA1
• Chromosome: 20
• Chromosome location: 20p11.23
• Summary: Insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors. [provided

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001751	hsa-miR-375	Other	15806104
MIRT1067752	hsa-miR-33a	CLIP-seq
MIRT1067753	hsa-miR-33b	CLIP-seq
MIRT1067754	hsa-miR-4311	CLIP-seq
MIRT1067755	hsa-miR-548a-5p	CLIP-seq
MIRT1067756	hsa-miR-548ab	CLIP-seq
MIRT1067757	hsa-miR-548ak	CLIP-seq
MIRT1067758	hsa-miR-548b-5p	CLIP-seq
MIRT1067759	hsa-miR-548c-5p	CLIP-seq
MIRT1067760	hsa-miR-548d-5p	CLIP-seq
MIRT1067761	hsa-miR-548h	CLIP-seq
MIRT1067762	hsa-miR-548i	CLIP-seq
MIRT1067763	hsa-miR-548j	CLIP-seq
MIRT1067764	hsa-miR-548n	CLIP-seq
MIRT1067765	hsa-miR-548t	CLIP-seq
MIRT1067766	hsa-miR-548w	CLIP-seq
MIRT1067767	hsa-miR-548y	CLIP-seq
MIRT1067768	hsa-miR-559	CLIP-seq
MIRT1067754	hsa-miR-4311	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREBBP	Activation	17300785
POU1F1	Unknown	8188699

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11842116, 16569215, 18417529, 19124461
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11842116, 16569215, 18417529
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	16569215
GO:0001933	Process	Negative regulation of protein phosphorylation	IDA	19124461
GO:0003309	Process	Type B pancreatic cell differentiation	ISS
GO:0003310	Process	Pancreatic A cell differentiation	ISS
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0003358	Process	Noradrenergic neuron development	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11842116, 16569215, 18417529
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0007049	Process	Cell cycle	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19124461
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010564	Process	Regulation of cell cycle process	IBA	21873635
GO:0017053	Component	Transcription repressor complex	IBA	21873635
GO:0017053	Component	Transcription repressor complex	IDA	16569215, 18417529
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030332	Function	Cyclin binding	IPI	16569215, 18417529, 19124461
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031018	Process	Endocrine pancreas development	TAS
GO:0031490	Function	Chromatin DNA binding	IDA	16569215, 18417529
GO:0042421	Process	Norepinephrine biosynthetic process	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	16569215, 18417529
GO:0043254	Process	Regulation of protein-containing complex assembly	IDA	19124461
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0060290	Process	Transdifferentiation	IDA	16511571
GO:0061104	Process	Adrenal chromaffin cell differentiation	ISS
GO:0061549	Process	Sympathetic ganglion development	ISS
GO:0071158	Process	Positive regulation of cell cycle arrest	IDA	19124461
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	ISS

Other IDs

• MIM: 600010
• HGNC: 6090
• e!Ensembl: ENSG00000173404

Protein

• UniProt ID: Q01101
• Protein name: Insulinoma-associated protein 1 (Zinc finger protein IA-1)
• Protein function: Sequence-specific DNA-binding transcriptional regulator that plays a key role in neurogenesis and neuroendocrine cell differentiation during embryonic and/or fetal development. Binds to the consensus sequence 5'-[TG][TC][TC][TT][GA]GGG[CG]A-3' i
• PDB: 2LV2, 3ZMS, 8JPY, 8JQ1, 8K81
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	295 → 317	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	367 → 390	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	440 → 464	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	469 → 492	Zinc finger, C2H2 type	Domain

• Sequence:

  MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAE
  RAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSF
  NLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAA
  RGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLHFEDEVTTSPV
  LGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPEC
  AKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRDTPSPGGVSES
  GSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ
  EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYS
  SPGLTRHINKCHPSENRQVILLQVPVRPAC

• Sequence length: 510

Pathways

Reactome:

Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lung carcinoma	Small cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	23582323