INPP5D (inositol polyphosphate-5-phosphatase D)

Gene

• Entrez ID: 3635
• Gene name: Inositol polyphosphate-5-phosphatase D
• Gene symbol: INPP5D
• Synonyms: SHIP, SHIP-1, SHIP1, SIP-145, hp51CN, p150Ship
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	19890474
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay, Western blot	20041145
MIRT000631	hsa-miR-155-5p	Luciferase reporter assay	19359473
MIRT000631	hsa-miR-155-5p	Review	20144731
MIRT000631	hsa-miR-155-5p	Review	20029422
MIRT000631	hsa-miR-155-5p	GFP reporter assay, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	19641183
MIRT000631	hsa-miR-155-5p	Reporter assay	20041145
MIRT000631	hsa-miR-155-5p	Reporter assay;Western blot;qRT-PCR;Other	19359473
MIRT030268	hsa-miR-26b-5p	Microarray	19088304
MIRT038735	hsa-miR-93-3p	CLASH	23622248
MIRT000631	hsa-miR-155-5p	qRT-PCR, Western blot	22982040
MIRT000631	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24522920
MIRT000631	hsa-miR-155-5p	EMSA, Flow, Luciferase reporter assay, qRT-PCR, Western blot	25971362
MIRT000631	hsa-miR-155-5p	qRT-PCR	36071352
MIRT1067364	hsa-miR-1271	CLIP-seq
MIRT1067365	hsa-miR-3614-5p	CLIP-seq
MIRT1067366	hsa-miR-3659	CLIP-seq
MIRT1067367	hsa-miR-4255	CLIP-seq
MIRT1067368	hsa-miR-4658	CLIP-seq
MIRT1067369	hsa-miR-574-5p	CLIP-seq
MIRT1067370	hsa-miR-96	CLIP-seq
MIRT1067371	hsa-miR-214	CLIP-seq
MIRT1067372	hsa-miR-3619-5p	CLIP-seq
MIRT1067373	hsa-miR-4281	CLIP-seq
MIRT1067374	hsa-miR-4449	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq
MIRT1067376	hsa-miR-4530	CLIP-seq
MIRT1067377	hsa-miR-4722-5p	CLIP-seq
MIRT1067378	hsa-miR-761	CLIP-seq
MIRT1067379	hsa-miR-765	CLIP-seq
MIRT2016314	hsa-miR-4795-3p	CLIP-seq
MIRT2016315	hsa-miR-329	CLIP-seq
MIRT2016316	hsa-miR-362-3p	CLIP-seq
MIRT2248618	hsa-miR-3616-3p	CLIP-seq
MIRT2248619	hsa-miR-4779	CLIP-seq
MIRT1067375	hsa-miR-4459	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004439	Function	Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA
GO:0004445	Function	Inositol-polyphosphate 5-phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	9148918, 9485206, 10382761, 15090612, 16339535, 19843936, 20933011, 21712384, 24642916, 25416956, 26221972, 26755705
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0006796	Process	Phosphate-containing compound metabolic process	TAS	8769125
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	8769125
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016314	Function	Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity	TAS
GO:0017124	Function	SH3 domain binding	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0045121	Component	Membrane raft	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045656	Process	Negative regulation of monocyte differentiation	IEA
GO:0045659	Process	Negative regulation of neutrophil differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0046856	Process	Phosphatidylinositol dephosphorylation	IEA
GO:0050777	Process	Negative regulation of immune response	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050900	Process	Leukocyte migration	TAS
GO:0052658	Function	Inositol-1,4,5-trisphosphate 5-phosphatase activity	IEA
GO:0052659	Function	Inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity	IEA

Other IDs

• MIM: 601582
• HGNC: 6079
• e!Ensembl: ENSG00000168918

Protein

• UniProt ID: Q92835
• Protein name: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (EC 3.1.3.86) (Inositol polyphosphate-5-phosphatase D) (EC 3.1.3.56) (Inositol polyphosphate-5-phosphatase of 145 kDa) (SIP-145) (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase) (EC 3.1.3.36) (
• Protein function: Phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2, thereby negatively regulating the PI3K (phosphoinositide 3-kinase) pat
• PDB: 2YSX, 5RW2, 5RW3, 5RW4, 5RW5, 5RW6, 5RW7, 5RW8, 5RW9, 5RWA, 5RWB, 5RWC, 5RWD, 5RWE, 5RWF, 5RWG, 5RWH, 5RWI, 5RWJ, 5RWK, 5RWL, 5RWM, 5RWN, 5RWO, 5RWP, 5RWQ, 5RWR, 5RWS, 5RWT, 5RWU, 5RWV, 5RWW, 5RWX, 5RWY, 5RWZ, 5RX0, 5RX1, 5RX2, 5RX3, 5RX4, 5RX5, 5RX6, 5RX7, 5RX8, 5RX9, 5RXA, 5RXB, 5RXC, 5RXD, 5RXE, 5RXF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	5 → 86	SH2 domain	Domain
  PF03372	Exo_endo_phos	409 → 701	Endonuclease/Exonuclease/phosphatase family	Domain

• Sequence:

  MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
  DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
  VSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
  LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
  QLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVT
  FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
  VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
  KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
  AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
  HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
  TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
  ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
  GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
  GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
  GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
  PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
  PPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
  LYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
  PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
  PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ

• Sequence length: 1189

Pathways

KEGG:

Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis

Reactome:

Synthesis of PIPs at the plasma membrane
Synthesis of IP3 and IP4 in the cytosol
Downstream TCR signaling
PECAM1 interactions
Interleukin receptor SHC signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	30320580, 24162737, 30320580, 30617256, 29777097
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928	26503814

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema		30595370
Senile dementia	Presenile dementia, Acute Confusional Senile Dementia		30320580