ILK (integrin linked kinase)

Gene

• Entrez ID: 3611
• Gene name: Integrin linked kinase
• Gene symbol: ILK
• Synonyms: HEL-S-28, ILK-1, ILK-2, P59, p59ILK
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006720	hsa-miR-625-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22677169
MIRT007009	hsa-miR-542-3p	Immunoblot, Immunocytochemistry, Luciferase reporter assay	21860426
MIRT007180	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104321
MIRT046790	hsa-miR-222-3p	CLASH	23622248
MIRT037481	hsa-miR-744-5p	CLASH	23622248
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT007009	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT007009	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT1065583	hsa-miR-31	CLIP-seq
MIRT1065584	hsa-miR-3688-5p	CLIP-seq
MIRT1065585	hsa-miR-4504	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT2682818	hsa-miR-361-3p	CLIP-seq
MIRT2682819	hsa-miR-3679-3p	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ERG	Repression	23027626
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IMP	30254023
GO:0001725	Component	Stress fiber	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	10637513
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9366252, 10871859
GO:0005515	Function	Protein binding	IPI	11331308, 11331582, 12432066, 15817463, 16189514, 16936772, 17003112, 17553790, 18339839, 19074270, 20926685, 21516116, 21643011, 23414517, 23455922, 23877428, 25416956, 25502805, 25852190, 26496610, 26972000, 28514442, 30254023, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	30254023
GO:0006468	Process	Protein phosphorylation	IDA	10871859
GO:0007160	Process	Cell-matrix adhesion	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9366252
GO:0009967	Process	Positive regulation of signal transduction	IMP	10637513
GO:0016020	Component	Membrane	HDA	19946888
GO:0019901	Function	Protein kinase binding	IPI	19118217
GO:0030017	Component	Sarcomere	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	21343177
GO:0034329	Process	Cell junction assembly	TAS
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA	21873635
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	19118217
GO:0042327	Process	Positive regulation of phosphorylation	IMP	20018240
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	20018240
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	20018240
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IGI	30254023
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IMP	21343177

Other IDs

• MIM: 602366
• HGNC: 6040
• e!Ensembl: ENSG00000166333

Protein

• UniProt ID: Q13418
• Protein name: Scaffold protein ILK (ILK-1) (ILK-2) (Inactive integrin-linked kinase) (p59ILK)
• Protein function: Scaffold protein which mediates protein-protein interactions during a range of cellular events including focal adhesion assembly, cell adhesion and cell migration (PubMed:17420447, PubMed:20005845, PubMed:30367047, PubMed:32528174). Regulates in
• PDB: 2KBX, 3F6Q, 3IXE, 3KMU, 3KMW, 3REP, 4HI8, 4HI9, 6MIB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13857	Ank_5	60 → 107		Repeat
  PF12796	Ank_2	63 → 130	Ankyrin repeats (3 copies)	Repeat
  PF07714	PK_Tyr_Ser-Thr	193 → 446	Protein tyrosine and serine/threonine kinase	Domain

• Sequence:

  MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
  NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
  ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
  TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
  RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
  MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
  LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
  VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

• Sequence length: 452

Pathways

KEGG:

PPAR signaling pathway
Axon guidance
Focal adhesion
Bacterial invasion of epithelial cells
Shigellosis
Endometrial cancer

Reactome:

Localization of the PINCH-ILK-PARVIN complex to focal adhesions
Cell-extracellular matrix interactions

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	20064661

Unknown
Disease name	Disease term	dbSNP ID	References
Cerebral ischemia	Brain Stem Ischemia, Transient, Transient Cerebral Ischemia		15472100
Malignant mesothelioma	Malignant mesothelioma		23045294
Thoracic diseases	Thoracic Diseases		23045294
Transient ischemic attack	Transient Ischemic Attack, Posterior Circulation Transient Ischemic Attack, Carotid Circulation Transient Ischemic Attack, Transient Ischemic Attack, Vertebrobasilar Circulation, Crescendo Transient Ischemic Attacks, Transient Ischemic Attack, Anterior Circulation		15472100