IL15 (interleukin 15)

Gene

• Entrez ID: 3600
• Gene name: Interleukin 15
• Gene symbol: IL15
• Synonyms: IL-15
• Chromosome: 4
• Chromosome location: 4q31.21
• Summary: The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024918	hsa-miR-215-5p	Microarray	19074876
MIRT026532	hsa-miR-192-5p	Microarray	19074876
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT736114	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	33066457
MIRT736423	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT1063730	hsa-miR-936	CLIP-seq
MIRT2247390	hsa-miR-1264	CLIP-seq
MIRT2247391	hsa-miR-4251	CLIP-seq
MIRT2247392	hsa-miR-4329	CLIP-seq
MIRT2389340	hsa-miR-140-5p	CLIP-seq
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT2389341	hsa-miR-4676-5p	CLIP-seq
MIRT2389342	hsa-miR-4697-3p	CLIP-seq
MIRT2389343	hsa-miR-4712-3p	CLIP-seq
MIRT2389344	hsa-miR-575	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2550849	hsa-miR-130a	CLIP-seq
MIRT2550850	hsa-miR-130b	CLIP-seq
MIRT2550851	hsa-miR-148a	CLIP-seq
MIRT2550852	hsa-miR-148b	CLIP-seq
MIRT2550853	hsa-miR-152	CLIP-seq
MIRT2550854	hsa-miR-301a	CLIP-seq
MIRT2550855	hsa-miR-301b	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2550858	hsa-miR-3666	CLIP-seq
MIRT2550859	hsa-miR-4295	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550862	hsa-miR-454	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550865	hsa-miR-548ad	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2550875	hsa-miR-891b	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2682752	hsa-miR-2052	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2682753	hsa-miR-3659	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2682754	hsa-miR-654-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HOXA10	Activation	20478621
MYB	Activation	11675351

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IBA	21873635
GO:0001866	Process	NK T cell proliferation	IEA
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	16284400, 23104097, 25416956
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	10851076
GO:0005768	Component	Endosome	TAS
GO:0005794	Component	Golgi apparatus	TAS	10851076
GO:0005829	Component	Cytosol	IDA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	8178155
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	12244150
GO:0007267	Process	Cell-cell signaling	TAS	7759105
GO:0007568	Process	Aging	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10851076
GO:0009986	Component	Cell surface	IEA
GO:0014732	Process	Skeletal muscle atrophy	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030212	Process	Hyaluronan metabolic process	IEA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	15123770, 24942581
GO:0035723	Process	Interleukin-15-mediated signaling pathway	TAS
GO:0042102	Process	Positive regulation of T cell proliferation	IBA	21873635
GO:0042119	Process	Neutrophil activation	IBA	21873635
GO:0042119	Process	Neutrophil activation	IDA	15123770
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0045062	Process	Extrathymic T cell selection	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0050691	Process	Regulation of defense response to virus by host	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15123770
GO:0050766	Process	Positive regulation of phagocytosis	IDA	15123770
GO:0050778	Process	Positive regulation of immune response	IBA	21873635
GO:0071305	Process	Cellular response to vitamin D	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	27684068
GO:1904100	Process	Positive regulation of protein O-linked glycosylation	IEA

Other IDs

• MIM: 600554
• HGNC: 5977
• e!Ensembl: ENSG00000164136

Protein

• UniProt ID: P40933
• Protein name: Interleukin-15 (IL-15)
• Protein function: Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems (PubMed:15123770). Stimulates the p
• PDB: 2XQB, 2Z3Q, 2Z3R, 4GS7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02372	IL15	33 → 160	Interleukin 15	Domain

• Sequence:

  MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
  EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
  SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

• Sequence length: 162

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
TNF signaling pathway
Intestinal immune network for IgA production
Human T-cell leukemia virus 1 infection
Pathways in cancer
Rheumatoid arthritis

Reactome:

Interleukin-15 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	18929414

Unknown
Disease name	Disease term	dbSNP ID	References
Celiac disease	Celiac Disease	rs2305764, rs35218876	23269601
Endometrioma	Endometrioma		21063030
Endometriosis	Endometriosis	rs1800629, rs1143634	21063030