IL12A (interleukin 12A)

Gene

• Entrez ID: 3592
• Gene name: Interleukin 12A
• Gene symbol: IL12A
• Synonyms: CLMF, IL-12A, NFSK, NKSF1, P35
• Chromosome: 3
• Chromosome location: 3q25.33
• Summary: This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030009	hsa-miR-26b-5p	Microarray	19088304
MIRT208864	hsa-miR-21-5p	Microarray, qRT-PCR	22815788
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT208864	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27571873
MIRT1063591	hsa-miR-1237	CLIP-seq
MIRT1063592	hsa-miR-1248	CLIP-seq
MIRT1063593	hsa-miR-2116	CLIP-seq
MIRT1063594	hsa-miR-3124-3p	CLIP-seq
MIRT1063595	hsa-miR-3163	CLIP-seq
MIRT1063596	hsa-miR-3168	CLIP-seq
MIRT1063597	hsa-miR-340	CLIP-seq
MIRT1063598	hsa-miR-3662	CLIP-seq
MIRT1063599	hsa-miR-3679-3p	CLIP-seq
MIRT1063600	hsa-miR-3973	CLIP-seq
MIRT1063601	hsa-miR-4760-3p	CLIP-seq
MIRT1063602	hsa-miR-520g	CLIP-seq
MIRT1063603	hsa-miR-520h	CLIP-seq
MIRT1063604	hsa-miR-548c-3p	CLIP-seq
MIRT1063605	hsa-miR-549	CLIP-seq
MIRT1063606	hsa-miR-561	CLIP-seq
MIRT1063607	hsa-miR-607	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Unknown	16622221
IRF8	Unknown	16622221
JUN	Unknown	22904313
NFKB1	Activation	18690006
RELA	Activation	18690006

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IDA	1674604, 2204066
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	TAS	1673147
GO:0005143	Function	Interleukin-12 receptor binding	NAS	1674604
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	16456693
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0006955	Process	Immune response	TAS	9789052
GO:0007050	Process	Cell cycle arrest	IDA	16942485
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008083	Function	Growth factor activity	NAS	1673147
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016032	Process	Viral process	IEA
GO:0016477	Process	Cell migration	IDA	7903063
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031906	Component	Late endosome lumen	TAS
GO:0032496	Process	Response to lipopolysaccharide	IDA	7605994, 8557999
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	1674604, 11114383, 19088061
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0042163	Function	Interleukin-12 beta subunit binding	IPI	11023671
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	12372421
GO:0043514	Component	Interleukin-12 complex	IDA	2204066, 11023671, 11114383
GO:0043514	Component	Interleukin-12 complex	NAS	1674604, 14718574
GO:0045513	Function	Interleukin-27 binding	IPI	9342359
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	2204066
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604, 2204066
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050830	Process	Defense response to Gram-positive bacterium	IEP	1357073
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0070757	Process	Interleukin-35-mediated signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	16942485
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	25754930

Other IDs

• MIM: 161560
• HGNC: 5969
• e!Ensembl: ENSG00000168811

Protein

• UniProt ID: P29459
• Protein name: Interleukin-12 subunit alpha (IL-12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL-12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)
• Protein function: Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine (PubMed:8605935, PubMed:8943050). IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells
• PDB: 1F45, 3HMX, 8XRP, 8YI7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03039	IL12	6 → 219	Interleukin-12 alpha subunit	Domain

• Sequence:

  MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
  FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
  ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
  SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

• Sequence length: 219

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Alcoholic liver disease
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Inflammatory bowel disease
Allograft rejection
Lipid and atherosclerosis

Reactome:

Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Interleukin-35 Signalling
Interleukin-12 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Behcet syndrome	Behcet Syndrome, Behçet disease	rs886040969, rs886039866, rs746055479, rs752615209, rs774164456, rs751454741	25799145
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322, rs121917775, rs121917735, rs121917736, rs137853199, rs137853200, rs121917867, rs121917869, rs121913555, rs104893736, rs121909595, rs121909596, rs121909597, rs28931605, rs121909598, rs104893618, rs1695062782, rs74315486, rs74315487, rs74315490, rs74315489, rs745938679, rs1566402656, rs74315439, rs74315441, rs121912973, rs121917823, rs1593332981, rs121917825, rs121917827, rs113994108, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs750207077, rs387907336, rs387907337, rs387907342, rs140332366, rs397514703, rs398122937, rs398122378, rs398122392, rs398122944, rs137853924, rs398122947, rs397515623, rs397515624, rs397515625, rs397515626, rs398122948, rs587778872, rs398123066, rs587777601, rs370424081, rs786205221, rs786205222, rs864309684, rs864309688, rs864309701, rs864309689, rs864309690, rs864309681, rs864309686, rs864309696, rs864309693, rs864309687, rs864309691, rs864309692, rs864309695, rs864309678, rs864309685, rs864309700, rs864309698, rs864309683, rs864309682, rs864309679, rs111534978, rs864309680, rs864309702, rs864622780, rs756898971, rs869312732, rs775038545, rs878852983, rs1114167312, rs1114167313, rs1114167314, rs1114167315, rs1114167307, rs886041410, rs886041412, rs1057518738, rs1057517926, rs1057518878, rs1057519616, rs12799308, rs1064793935, rs1064797219, rs1085307126, rs1085307127, rs765628635, rs1114167427, rs1114167433, rs1554744860, rs1554743428, rs747093432, rs1411557416, rs1555179713, rs1481963503, rs1555549755, rs1456161420, rs1555547008, rs1555889308, rs1555888762, rs766522434, rs1264025914, rs1553585262, rs1567671947, rs1337897299, rs764945940, rs1307969607, rs949335475, rs1184095219, rs776129797, rs1569203234, rs1567668570, rs749141857, rs764098604, rs1184398243, rs1578956689, rs1568480054, rs1564745688, rs1564722302, rs1564723150, rs1571175950, rs1569602837, rs1576552712, rs1575369255, rs981126461, rs1570403798, rs200557771, rs1477743112, rs1651879427, rs1651881222, rs1651919374, rs2024441691, rs148284531, rs1246080692
Developmental regression	Developmental regression	rs1224421127
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701	18176109
Liver failure	Liver Failure	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116, rs776797592, rs1490906786, rs1562849964, rs759960319, rs776597537, rs375350359, rs1573008071, rs1601977105, rs1174791046, rs1019313682
Migraine	Migraine Disorders	rs794727411
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	24076602
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287
Renal insufficiency	Renal Insufficiency	rs1596536873
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771, rs766602945, rs1601419986, rs1489114116, rs754904956, rs755007390, rs368615054

Unknown
Disease name	Disease term	dbSNP ID	References
Acne	Acne
Anorexia	Anorexia
Aortic valve insufficiency	Aortic Valve Insufficiency
Aphthous ulcer	Recurrent aphthous ulcer
Biliary cholangitis	Primary biliary cholangitis, Secondary Biliary Cholangitis		20639880
Biliary cirrhosis	Biliary cirrhosis, Biliary Cirrhosis, Primary, 1, Primary biliary cirrhosis		20639880, 28425483, 20639880, 22961000
Celiac disease	Celiac Disease	rs2305764, rs35218876
Cirrhosis	Cirrhosis	rs119465999, rs144369314, rs8056684, rs112053857, rs75998507
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia
Cranial nerve paralysis	Cranial nerve palsies
Dermatographic urticaria	Dermatographic urticaria
Encephalitis	Encephalitis
Endocarditis	Endocarditis
Gangrene	Gangrene
Gastrointestinal inflammation	Gastrointestinal inflammation
Hypoalbuminemia	Hypoalbuminemia
Keratoconjunctivitis sicca	Keratoconjunctivitis Sicca
Liver neoplasms	Liver neoplasms		17326190
Liver cancer	Malignant neoplasm of liver		17326190
Liver carcinoma	Liver carcinoma
Liver fibrosis	Fibrosis, Liver
Malabsorption syndrome	Malabsorption Syndrome
Myositis	Myositis
Oral ulcer	Oral Ulcer
Pancreatitis	Pancreatitis	rs61734659
Pericarditis	Pericarditis
Pleural effusion	Pleural effusion disorder
Pleuritis	Pleurisy
Portal hypertension	Portal Hypertension
Renal glomerular disease	Renal glomerular disease
Retinal diseases	Retinal Diseases
Retrobulbar neuritis	Retrobulbar Neuritis
Sjogren`s syndrome	Sicca Syndrome, Sjogren`s Syndrome		24097067