GediPNet logo

IL10RA (interleukin 10 receptor subunit alpha)
Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3587
Gene nameGene Name - the full gene name approved by the HGNC.
Interleukin 10 receptor subunit alpha
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IL10RA
SynonymsGene synonyms aliases
CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammator
SNPsSNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
SNP ID Visualize variation Clinical significance Consequence
rs137853579 G>A,C Pathogenic Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
rs137853580 C>T Pathogenic Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs138929400 T>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs148808529 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, synonymous variant, coding sequence variant
rs149491038 C>T Pathogenic Non coding transcript variant, missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
miRTarBase ID miRNA Experiments Reference
MIRT491524 hsa-miR-556-5p PAR-CLIP 23592263
MIRT491523 hsa-miR-548q PAR-CLIP 23592263
MIRT491522 hsa-miR-3160-3p PAR-CLIP 23592263
MIRT491521 hsa-miR-558 PAR-CLIP 23592263
MIRT491520 hsa-miR-4487 PAR-CLIP 23592263
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
GO ID Ontology Definition Evidence Reference
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004920 Function Interleukin-10 receptor activity IEA
GO:0005515 Function Protein binding IPI 11485736, 12093920, 12513909, 15837194, 16982608, 18395809, 20462497, 22087322, 24008843, 32296183
GO:0005829 Component Cytosol IDA
GO:0005886 Component Plasma membrane IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM
HGNC
e!Ensembl
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13651
Protein name Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
Protein function Cell surface receptor for the cytokine IL10 that participates in IL10-mediated anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Upon binding to IL10, induces a conformational change in IL10RB, allowing IL
PDB 1J7V , 1LQS , 1Y6K , 1Y6M , 1Y6N , 5IXI , 6X93
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01108 Tissue_fac
4 → 111
Tissue factor
 Family
Sequence 
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE
Sequence length 578
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
 
KEGG
  
Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
JAK-STAT signaling pathway
Toxoplasmosis
Tuberculosis
Human cytomegalovirus infection 		  Interleukin-10 signaling
Associated diseases
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Causal
Disease name Disease term dbSNP ID References
Inflammatory bowel disease Inflammatory Bowel Diseases, INFLAMMATORY BOWEL DISEASE 28, AUTOSOMAL RECESSIVE rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs139868987, rs750447828, rs368138379, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 27302973, 29059189, 24785691, 23839161, 27302973, 19890111
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 17066477
Unknown
Disease name Disease term dbSNP ID References
Enterocolitis Enterocolitis
Folliculitis Folliculitis
Perianal abscess Perianal abscess
Pyoderma Pyoderma

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412