GediPNet logo

IL6R (interleukin 6 receptor)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3570
Gene nameGene Name - the full gene name approved by the HGNC.
Interleukin 6 receptor
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IL6R
SynonymsGene synonyms aliases
CD126, HIES5, IL-1Ra, IL-6R, IL-6R-1, IL-6RA, IL6Q, IL6QTL, IL6RA, IL6RQ, gp80
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein comple
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
Transcription factors
Transcription factor Regulation Reference
PPARA Repression 14764586
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002384 Process Hepatic immune response TAS 12832423
GO:0002548 Process Monocyte chemotaxis IC 10510402
GO:0002690 Process Positive regulation of leukocyte chemotaxis TAS 15100312
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004897 Function Ciliary neurotrophic factor receptor activity IMP 12643274
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P08887
Protein name Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
Protein function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed:28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-
PDB 1N26 , 1P9M , 2ARW , 5FUC , 7DC8 , 8D82 , 8IOW , 8QY5 , 8QY6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig
30 101
Immunoglobulin domain
Domain
PF09240 IL6Ra-bind
118 213
Interleukin-6 receptor alpha chain, binding
Domain
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGR
PAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGI
LQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Sequence length 468
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  EGFR tyrosine kinase inhibitor resistance
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
HIF-1 signaling pathway
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
Th17 cell differentiation
Non-alcoholic fatty liver disease
Human cytomegalovirus infection
Coronavirus disease - COVID-19
Pathways in cancer
  Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
Interleukin-4 and Interleukin-13 signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316 25340798
Aortic aneurysm Aortic Aneurysm, Abdominal rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953, rs794728021, rs8046180, rs797045725, rs876657852, rs878854466, rs886038978, rs746972765, rs886039303, rs886040965, rs886040966, rs886040967, rs886229659, rs1553781304, rs1060502531, rs1553795301, rs1553803235, rs1213452826, rs869025352, rs1553780501, rs1553785222, rs1382893400, rs1554841990, rs1430822242, rs1567692384, rs1576422965, rs1596712899, rs2059732940, rs2041090817, rs1439991530 27899403
Arthritis Systemic onset juvenile chronic arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 23603761
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 21907864, 29902480, 29273806
Unknown
Disease name Disease term dbSNP ID References
Ankylosing spondylitis Ankylosing spondylitis 23749187, 26974007
Cholangitis Cholangitis, Sclerosing 26974007
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma rs137853247 7834629
Coronary heart disease Coronary heart disease rs9289231, rs281864746 22319020

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412