IL3RA (interleukin 3 receptor subunit alpha)

Gene

• Entrez ID: 3563
• Gene name: Interleukin 3 receptor subunit alpha
• Gene symbol: IL3RA
• Synonyms: CD123, IL-3R-alpha, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
• Chromosome: X|Y
• Chromosome location: X;Y
• Summary: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2247754	hsa-miR-338-3p	CLIP-seq
MIRT2247755	hsa-miR-4530	CLIP-seq
MIRT2247756	hsa-miR-4676-5p	CLIP-seq
MIRT2247757	hsa-miR-575	CLIP-seq
MIRT2247758	hsa-miR-622	CLIP-seq
MIRT2247759	hsa-miR-933	CLIP-seq
MIRT2247754	hsa-miR-338-3p	CLIP-seq
MIRT2551395	hsa-miR-4520a-5p	CLIP-seq
MIRT2551396	hsa-miR-4520b-5p	CLIP-seq
MIRT2247755	hsa-miR-4530	CLIP-seq
MIRT2247756	hsa-miR-4676-5p	CLIP-seq
MIRT2247757	hsa-miR-575	CLIP-seq
MIRT2247759	hsa-miR-933	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0004912	Function	Interleukin-3 receptor activity	TAS	1833064
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0036016	Process	Cellular response to interleukin-3	IEA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IEA
GO:0043235	Component	Receptor complex	IBA	21873635

Other IDs

• MIM: 308385
• e!Ensembl: HGNC

Protein

• UniProt ID: P26951
• Protein name: Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
• Protein function: Cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes and B-lymphocytes that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed:10527461). Ligand sti
• PDB: 4JZJ, 5UV8, 5UWC, 6NMY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18611	IL3Ra_N	27 → 97	IL-3 receptor alpha chain N-terminal domain	Domain
  PF09240	IL6Ra-bind	109 → 205	Interleukin-6 receptor alpha chain, binding	Domain

• Sequence:

  MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
  PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
  SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
  HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
  QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
  TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
  KAGLEECLVTEVQVVQKT

• Sequence length: 378

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
JAK-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer

Reactome:

Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19281803, 17522711, 18547720