IL3 (interleukin 3)

Gene

• Entrez ID: 3562
• Gene name: Interleukin 3
• Gene symbol: IL3
• Synonyms: IL-3, MCGF, MULTI-CSF
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029305	hsa-miR-26b-5p	Microarray	19088304
MIRT053457	hsa-miR-452-5p	Microarray	23807165
MIRT1064862	hsa-miR-1229	CLIP-seq
MIRT1064863	hsa-miR-1286	CLIP-seq
MIRT1064864	hsa-miR-129-5p	CLIP-seq
MIRT1064865	hsa-miR-15a	CLIP-seq
MIRT1064866	hsa-miR-15b	CLIP-seq
MIRT1064867	hsa-miR-16	CLIP-seq
MIRT1064868	hsa-miR-195	CLIP-seq
MIRT1064869	hsa-miR-214	CLIP-seq
MIRT1064870	hsa-miR-298	CLIP-seq
MIRT1064871	hsa-miR-342-3p	CLIP-seq
MIRT1064872	hsa-miR-3619-5p	CLIP-seq
MIRT1064873	hsa-miR-3678-3p	CLIP-seq
MIRT1064874	hsa-miR-377	CLIP-seq
MIRT1064875	hsa-miR-424	CLIP-seq
MIRT1064876	hsa-miR-4436a	CLIP-seq
MIRT1064877	hsa-miR-450b-5p	CLIP-seq
MIRT1064878	hsa-miR-497	CLIP-seq
MIRT1064879	hsa-miR-507	CLIP-seq
MIRT1064880	hsa-miR-557	CLIP-seq
MIRT1064881	hsa-miR-759	CLIP-seq
MIRT1064882	hsa-miR-761	CLIP-seq
MIRT1064874	hsa-miR-377	CLIP-seq
MIRT1064863	hsa-miR-1286	CLIP-seq
MIRT1064865	hsa-miR-15a	CLIP-seq
MIRT1064866	hsa-miR-15b	CLIP-seq
MIRT1064867	hsa-miR-16	CLIP-seq
MIRT1064868	hsa-miR-195	CLIP-seq
MIRT1064869	hsa-miR-214	CLIP-seq
MIRT1064870	hsa-miR-298	CLIP-seq
MIRT1064872	hsa-miR-3619-5p	CLIP-seq
MIRT1064873	hsa-miR-3678-3p	CLIP-seq
MIRT1064875	hsa-miR-424	CLIP-seq
MIRT1064876	hsa-miR-4436a	CLIP-seq
MIRT1064877	hsa-miR-450b-5p	CLIP-seq
MIRT1064878	hsa-miR-497	CLIP-seq
MIRT1064879	hsa-miR-507	CLIP-seq
MIRT1064880	hsa-miR-557	CLIP-seq
MIRT1064882	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	10453008
CEBPB	Unknown	10453008
DNMT1	Repression	15735013
EGR1	Activation	8035792
ETS1	Unknown	8704203
JUN	Activation	7642615
JUNB	Unknown	8704203
JUND	Unknown	8704203
RUNX1	Repression	15735013
RUNX1T1	Unknown	15735013
SP1	Unknown	8454603
VEZF1	Activation	8035792

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	TAS
GO:0005125	Function	Cytokine activity	IEA
GO:0005135	Function	Interleukin-3 receptor binding	TAS	2544122
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	ISS
GO:0006955	Process	Immune response	IEA
GO:0007267	Process	Cell-cell signaling	TAS	3497400
GO:0007399	Process	Nervous system development	TAS	9736740
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	9722506
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0035162	Process	Embryonic hemopoiesis	IDA	21149635
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	9722506
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS

Other IDs

• MIM: 147740
• HGNC: 6011
• e!Ensembl: ENSG00000164399

Protein

• UniProt ID: P08700
• Protein name: Interleukin-3 (IL-3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony-stimulating factor) (P-cell-stimulating factor)
• Protein function: Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed:2556442). Also stimu
• PDB: 1JLI, 5UV8, 5UWC, 6NMY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02059	IL3	20 → 137	Interleukin-3	Domain

• Sequence:

  MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
  GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
  GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

• Sequence length: 152

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
JAK-STAT signaling pathway
Hematopoietic cell lineage
Fc epsilon RI signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Asthma

Reactome:

Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF/MAP kinase cascade
RUNX1 regulates transcription of genes involved in interleukin signaling
Interleukin receptor SHC signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505	12090760, 8202718
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18804346, 18547720, 19281803, 17667962, 17179997

Unknown
Disease name	Disease term	dbSNP ID	References
Leukopenia	Leukopenia		8202718
Malignant mesothelioma	Malignant mesothelioma		25162674
Non-alcoholic fatty liver disease	Non-alcoholic Fatty Liver Disease, Nonalcoholic Steatohepatitis		21664615