IL2RB (interleukin 2 receptor subunit beta)

Gene

• Entrez ID: 3560
• Gene name: Interleukin 2 receptor subunit beta
• Gene symbol: IL2RB
• Synonyms: CD122, IL15RB, IMD63, P70-75
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1569044747	G>A	Pathogenic	Coding sequence variant, stop gained
rs1601598133	GGCTCCAGG>-	Pathogenic	Inframe deletion, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT475221	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT475220	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT475219	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT475218	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475217	hsa-miR-4510	PAR-CLIP	23592263
MIRT475216	hsa-miR-6127	PAR-CLIP	23592263
MIRT475215	hsa-miR-6129	PAR-CLIP	23592263
MIRT475214	hsa-miR-6130	PAR-CLIP	23592263
MIRT475213	hsa-miR-6133	PAR-CLIP	23592263
MIRT475211	hsa-miR-4300	PAR-CLIP	23592263
MIRT475212	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT475210	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT475209	hsa-miR-920	PAR-CLIP	23592263
MIRT475208	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT475207	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT475206	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT475204	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT475205	hsa-miR-4455	PAR-CLIP	23592263
MIRT475203	hsa-miR-4316	PAR-CLIP	23592263
MIRT475202	hsa-miR-1294	PAR-CLIP	23592263
MIRT475201	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT475221	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT475220	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT475219	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT475218	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475217	hsa-miR-4510	PAR-CLIP	23592263
MIRT475216	hsa-miR-6127	PAR-CLIP	23592263
MIRT475215	hsa-miR-6129	PAR-CLIP	23592263
MIRT475214	hsa-miR-6130	PAR-CLIP	23592263
MIRT475213	hsa-miR-6133	PAR-CLIP	23592263
MIRT475211	hsa-miR-4300	PAR-CLIP	23592263
MIRT475212	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT475210	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT475209	hsa-miR-920	PAR-CLIP	23592263
MIRT475208	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT475207	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT475206	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT475204	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT475205	hsa-miR-4455	PAR-CLIP	23592263
MIRT475203	hsa-miR-4316	PAR-CLIP	23592263
MIRT475202	hsa-miR-1294	PAR-CLIP	23592263
MIRT475201	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT1064826	hsa-miR-103a	CLIP-seq
MIRT1064827	hsa-miR-107	CLIP-seq
MIRT1064828	hsa-miR-1224-5p	CLIP-seq
MIRT1064829	hsa-miR-1269	CLIP-seq
MIRT1064830	hsa-miR-1269b	CLIP-seq
MIRT1064831	hsa-miR-1288	CLIP-seq
MIRT1064832	hsa-miR-214	CLIP-seq
MIRT1064833	hsa-miR-3127-5p	CLIP-seq
MIRT1064834	hsa-miR-3619-5p	CLIP-seq
MIRT1064835	hsa-miR-3909	CLIP-seq
MIRT1064836	hsa-miR-3918	CLIP-seq
MIRT1064837	hsa-miR-4291	CLIP-seq
MIRT1064838	hsa-miR-4515	CLIP-seq
MIRT1064839	hsa-miR-4519	CLIP-seq
MIRT1064840	hsa-miR-4687-5p	CLIP-seq
MIRT1064841	hsa-miR-4711-5p	CLIP-seq
MIRT1064842	hsa-miR-4740-5p	CLIP-seq
MIRT1064843	hsa-miR-4751	CLIP-seq
MIRT1064844	hsa-miR-4755-3p	CLIP-seq
MIRT1064845	hsa-miR-522	CLIP-seq
MIRT1064846	hsa-miR-761	CLIP-seq
MIRT1064847	hsa-miR-885-3p	CLIP-seq
MIRT1064848	hsa-miR-922	CLIP-seq
MIRT2015424	hsa-miR-15a	CLIP-seq
MIRT2015425	hsa-miR-15b	CLIP-seq
MIRT2015426	hsa-miR-16	CLIP-seq
MIRT2015427	hsa-miR-195	CLIP-seq
MIRT1064832	hsa-miR-214	CLIP-seq
MIRT1064834	hsa-miR-3619-5p	CLIP-seq
MIRT2015428	hsa-miR-424	CLIP-seq
MIRT1064839	hsa-miR-4519	CLIP-seq
MIRT2015429	hsa-miR-497	CLIP-seq
MIRT1064846	hsa-miR-761	CLIP-seq
MIRT2247724	hsa-miR-1207-5p	CLIP-seq
MIRT2247725	hsa-miR-1914	CLIP-seq
MIRT2247726	hsa-miR-1915	CLIP-seq
MIRT1064833	hsa-miR-3127-5p	CLIP-seq
MIRT2247727	hsa-miR-3151	CLIP-seq
MIRT2247728	hsa-miR-34a	CLIP-seq
MIRT2247729	hsa-miR-34c-5p	CLIP-seq
MIRT2247730	hsa-miR-3616-3p	CLIP-seq
MIRT2247731	hsa-miR-3649	CLIP-seq
MIRT1064836	hsa-miR-3918	CLIP-seq
MIRT2247732	hsa-miR-4278	CLIP-seq
MIRT2247733	hsa-miR-4283	CLIP-seq
MIRT2247734	hsa-miR-4436b-3p	CLIP-seq
MIRT2247735	hsa-miR-4459	CLIP-seq
MIRT2247736	hsa-miR-4489	CLIP-seq
MIRT2247737	hsa-miR-449a	CLIP-seq
MIRT2247738	hsa-miR-449b	CLIP-seq
MIRT2247739	hsa-miR-4648	CLIP-seq
MIRT2247740	hsa-miR-4656	CLIP-seq
MIRT2247741	hsa-miR-4716-3p	CLIP-seq
MIRT2247742	hsa-miR-4721	CLIP-seq
MIRT2247743	hsa-miR-4722-5p	CLIP-seq
MIRT2247744	hsa-miR-4763-3p	CLIP-seq
MIRT2247745	hsa-miR-4795-5p	CLIP-seq
MIRT2247746	hsa-miR-492	CLIP-seq
MIRT2430015	hsa-miR-1225-3p	CLIP-seq
MIRT2430016	hsa-miR-3911	CLIP-seq
MIRT2430017	hsa-miR-4527	CLIP-seq
MIRT2437895	hsa-miR-138	CLIP-seq
MIRT2247727	hsa-miR-3151	CLIP-seq
MIRT2437896	hsa-miR-3929	CLIP-seq
MIRT2437897	hsa-miR-4419b	CLIP-seq
MIRT2437898	hsa-miR-4447	CLIP-seq
MIRT2437899	hsa-miR-4472	CLIP-seq
MIRT2437900	hsa-miR-4478	CLIP-seq
MIRT2437901	hsa-miR-491-5p	CLIP-seq
MIRT2451766	hsa-miR-296-5p	CLIP-seq
MIRT2451767	hsa-miR-635	CLIP-seq
MIRT2451768	hsa-miR-890	CLIP-seq
MIRT2451769	hsa-miR-938	CLIP-seq
MIRT2551234	hsa-miR-4312	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Unknown	9199305
ETS1	Activation	8413220
RXRA	Activation	12149223
SP1	Unknown	9199305
WT1	Unknown	11960373

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004911	Function	Interleukin-2 receptor activity	IDA	7736574
GO:0004911	Function	Interleukin-2 receptor activity	IMP	31040184, 31040185
GO:0004911	Function	Interleukin-2 receptor activity	IMP	2467293
GO:0005515	Function	Protein binding	IPI	16477002, 22446627, 23104097, 25416956, 32296183
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IMP	31040184, 31040185
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8514792
GO:0005893	Component	Interleukin-2 receptor complex	TAS	2467293
GO:0007165	Process	Signal transduction	TAS	2785715
GO:0009897	Component	External side of plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	15123770
GO:0009986	Component	Cell surface	IMP	31040184, 31040185
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	7736574
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019976	Function	Interleukin-2 binding	IMP	2467293, 31040184, 31040185
GO:0019976	Function	Interleukin-2 binding	ISS
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IMP	15123770, 31040184
GO:0035723	Process	Interleukin-15-mediated signaling pathway	TAS
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IMP	31040184
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS	2467293
GO:0042010	Function	Interleukin-15 receptor activity	IDA	15123770
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7736574
GO:0050766	Process	Positive regulation of phagocytosis	IMP	15123770
GO:0065003	Process	Protein-containing complex assembly	TAS	2467293

Other IDs

• MIM: 146710
• HGNC: 6009
• e!Ensembl: ENSG00000100385

Protein

• UniProt ID: P14784
• Protein name: Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)
• Protein function: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (PubMed:1
• PDB: 2B5I, 2ERJ, 3QAZ, 4GS7, 5M5E, 6E8K, 7S2S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18707	IL2RB_N1	32 → 123	Interleukin-2 receptor subunit beta N-terminal domain 1	Domain

• Sequence:

  MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
  VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
  IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
  APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
  IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
  QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
  NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
  FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
  DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
  ELQGQDPTHLV

• Sequence length: 551

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Endocytosis
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Measles
Human T-cell leukemia virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer

Reactome:

RAF/MAP kinase cascade
Interleukin-15 signaling
Interleukin-2 signaling
Interleukin receptor SHC signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Apraxia	Apraxias	rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Arthritis	Systemic onset juvenile chronic arthritis, Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	23603761
Arthrogryposis multiplex congenita	Arthrogryposis	rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835, rs758105619, rs886041851, rs794727136, rs755239192, rs760715690, rs773952935, rs112610938, rs1057516676, rs1057516996, rs780022652, rs1057517399, rs1057517360, rs1057518353, rs1057517977, rs1064796311, rs779232987, rs775997446, rs1064797093, rs1064797094, rs1064797095, rs755500591, rs754272530, rs758247804, rs200731870, rs747179265, rs1553740233, rs776569219, rs375628303, rs775631800, rs781667543, rs1553548666, rs928945364, rs763364977, rs1458048713, rs1553883480, rs1472403020, rs1336053002, rs202048855, rs1197561990, rs755531536, rs1554112524, rs762133567, rs1553555882, rs934111355, rs1255744452, rs1366269616, rs1555734932, rs1553548207, rs752582527, rs1257495033, rs113525641, rs755863625, rs374929094, rs539819851, rs1366853918, rs1218073575, rs1553537512, rs1553552384, rs747564597, rs776059611, rs756726488, rs1357811155, rs1553939600, rs772009599, rs1255445731, rs1011425121, rs1553561697, rs1553551748, rs1553552413, rs760935667, rs1553603400, rs1302373559, rs1389892619, rs1553710982, rs757157808, rs1180339426, rs761964375, rs1235589246, rs1443738549, rs1553934586, rs1553934597, rs1553603437, rs749452641, rs1553904694, rs754369875, rs112517981, rs774495973, rs1428597732, rs746999970, rs113091511, rs1553603958, rs1553469502, rs770797137, rs1553608621, rs1159756073, rs776167256, rs778593702, rs1553601066, rs1553689774, rs760768475, rs1559296376, rs201636991, rs1559039815, rs748922882, rs772366030, rs1207534366, rs1259297878, rs762780413, rs1559360386, rs1559940778, rs760200697, rs1344099907, rs750900690, rs1559168230, rs746177326, rs761067911, rs1323364980, rs537560378, rs1319778592, rs1340063197, rs1577833924, rs750585238, rs1600470099, rs1575714905, rs1576203853, rs779909544, rs760124743, rs2096362304, rs1212374733, rs1490309743, rs767709270, rs1374971806, rs2096491549, rs2097886912, rs2099021112, rs2097758221, rs1474341248, rs925947627
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	20860503, 21907864, 22561531
Autoimmune diseases	Autoimmune Diseases	rs41285370, rs869025224	21383967
Ichthyosis	Ichthyoses	rs199766569, rs587776996, rs587777262, rs863223405, rs370031870, rs1569044747, rs200806519
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	22190364
Rheumatoid arthritis	Rheumatoid Arthritis, Rheumatoid Arthritis, Systemic Juvenile	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	23143596, 17554300, 24532676, 20453842, 23603761

Unknown
Disease name	Disease term	dbSNP ID	References
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia
Bipolar disorder	Bipolar Disorder		16380905
Digestive system neuroendocrine neoplasm	Gastro-enteropancreatic neuroendocrine tumor		29915428
Ichthyosis congenita	Ichthyosiform Erythroderma, Congenital
Immune system diseases	Immune System Diseases		21383967
Immunologic deficiency syndromes	Immunologic Deficiency Syndromes
Iridocyclitis	Iridocyclitis
Oligoarticular arthritis	Oligoarticular Juvenile Idiopathic Arthritis		23603761
Otitis media	Recurrent otitis media	rs601338, rs1047781, rs1800028
Pauciarticular chronic arthritis	Juvenile pauciarticular chronic arthritis		23603761
Polyarthritis	Polyarthritis
Seronegative polyarthritis	Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative		23603761
Rheumatoid factor-negative polyarticular arthritis	Rheumatoid factor-negative polyarticular juvenile idiopathic arthritis
Still disease	Juvenile-Onset Still Disease		23603761