GediPNet logo

IL2RA (interleukin 2 receptor subunit alpha)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3559
Gene nameGene Name - the full gene name approved by the HGNC.
Interleukin 2 receptor subunit alpha
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
IL2RA
SynonymsGene synonyms aliases
CD25, IDDM10, IL2R, IMD41, TCGFR, p55
ChromosomeChromosome number
10
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p15.1
SummarySummary of gene provided in NCBI Entrez Gene.
The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2R
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs72650666 G>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs773957702 C>T Likely-pathogenic Coding sequence variant, missense variant
rs774803573 G>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs796051887 C>T Pathogenic Coding sequence variant, intron variant, missense variant
rs796051888 T>G Pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT631408 hsa-miR-1267 HITS-CLIP 23824327
MIRT631407 hsa-miR-367-5p HITS-CLIP 23824327
MIRT631406 hsa-miR-6499-3p HITS-CLIP 23824327
MIRT644980 hsa-miR-3194-3p HITS-CLIP 23824327
MIRT631405 hsa-miR-3135b HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
FOXP3 Activation 21036387
MSC Activation 19561533
NFKB1 Unknown 11781710;9135552
POU2F1 Unknown 9135552
REL Activation 1508203
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0002437 Process Inflammatory response to antigenic stimulus IEA
GO:0002664 Process Regulation of T cell tolerance induction IMP 23416241
GO:0004911 Function Interleukin-2 receptor activity IMP 2467293
GO:0005515 Function Protein binding IPI 16477002, 17032757
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P01589
Protein name Interleukin-2 receptor subunit alpha (IL-2 receptor subunit alpha) (IL-2-RA) (IL-2R subunit alpha) (IL2-RA) (TAC antigen) (p55) (CD antigen CD25)
Protein function Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. {ECO:0000269|PubMed:23416241, ECO
PDB 1Z92 , 2B5I , 2ERJ , 3IU3 , 3NFP , 6VWU , 6YIO , 7F9W , 7ZMZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00084 Sushi
24 82
Sushi repeat (SCR repeat)
Domain
Sequence
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQC
TSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Sequence length 272
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Endocytosis
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
Measles
Human T-cell leukemia virus 1 infection
Pathways in cancer
  RAF/MAP kinase cascade
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Interleukin-2 signaling
Interleukin receptor SHC signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Apraxia Apraxias rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Arthritis Systemic onset juvenile chronic arthritis, Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 23603761, 26301688
Asthma Asthma, Childhood asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 29785011, 31619474, 30929738, 30929738
Autoimmune diseases Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2 rs41285370, rs869025224 26301688, 30595370, 21383967, 26301688, 30595370, 30595370, 26301688
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia
Alopecia areata Alopecia Areata 20596022, 25608926
Ankylosing spondylitis Ankylosing spondylitis 26301688, 26974007
Autoimmune diabetes Diabetes, Autoimmune 17676041, 19701192, 19119414, 30224649

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412