IL2 (interleukin 2)

Gene

• Entrez ID: 3558
• Gene name: Interleukin 2
• Gene symbol: IL2
• Synonyms: IL-2, TCGF, lymphokine
• Chromosome: 4
• Chromosome location: 4q27
• Summary: This gene is a member of the interleukin 2 (IL2) cytokine subfamily which includes IL4, IL7, IL9, IL15, IL21, erythropoietin, and thrombopoietin. The protein encoded by this gene is a secreted cytokine produced by activated CD4+ and CD8+ T lymphocytes, th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025034	hsa-miR-181c-5p	Reporter assay;qRT-PCR;Other	21112091
MIRT041627	hsa-miR-484	CLASH	23622248
MIRT054292	hsa-miR-155-5p	qRT-PCR	22785227

Transcription factors

Transcription factor	Regulation	Reference
BACH2	Unknown	18769450
CREB1	Unknown	8814256
CREM	Repression	15841182
CREM	Unknown	12370343
EGR1	Unknown	12560487
ETS1	Repression	7876544
FOXK2	Unknown	16624804
FOXP3	Repression	18324310
HDAC1	Repression	17056544
ILF2	Unknown	9065434
ILF3	Activation	18097023
JUN	Repression	7642615
JUN	Unknown	8468462
KAT5	Unknown	11145913
KLF2	Unknown	16116194
NFATC1	Unknown	12560487
NFKB1	Activation	11035116;18207244;19968887;7623820;7957556;9233628
NFKB1	Unknown	11145913;12027419;15477007;8814256;8834450;8977179;9135552;9737979
POU2F1	Activation	11781715
POU2F1	Unknown	9135552
REL	Unknown	8920856
RELA	Activation	11035116;18207244;19968887;7623820;9233628
RELA	Unknown	11145913;12027419;15477007;8814256;8977179;9135552;9737979
RUNX1	Activation	17466384
SATB1	Unknown	15713622
SP1	Unknown	8814256
STAT3	Activation	18550668
TOB1	Repression	11694881
VDR	Repression	7565732
ZFP36	Repression	15634918

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002366	Process	Leukocyte activation involved in immune response	IDA	16204630
GO:0002639	Process	Positive regulation of immunoglobulin production	IGI	22962438
GO:0002903	Process	Negative regulation of B cell apoptotic process	IDA	9184696
GO:0005125	Function	Cytokine activity	IDA	1830926, 10072077
GO:0005134	Function	Interleukin-2 receptor binding	IDA	8262055
GO:0005134	Function	Interleukin-2 receptor binding	TAS	3925347
GO:0005515	Function	Protein binding	IPI	16477002, 17032757, 22446627
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	TAS	6608729
GO:0006955	Process	Immune response	TAS	2342538
GO:0007155	Process	Cell adhesion	TAS	10929056
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8476561
GO:0008083	Function	Growth factor activity	TAS	8476561
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8476561
GO:0010467	Process	Gene expression	IEA
GO:0019209	Function	Kinase activator activity	TAS	8476561
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030101	Process	Natural killer cell activation	TAS	8476561
GO:0030217	Process	T cell differentiation	TAS	8476561
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	8476561
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	9184696
GO:0031851	Function	Kappa-type opioid receptor binding	IEA
GO:0032729	Process	Positive regulation of interferon-gamma production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0033674	Process	Positive regulation of kinase activity	IEA
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	1830926, 10072077
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	19088061
GO:0043066	Process	Negative regulation of apoptotic process	TAS	8476561
GO:0043208	Function	Glycosphingolipid binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045589	Process	Regulation of regulatory T cell differentiation	TAS
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045822	Process	Negative regulation of heart contraction	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046013	Process	Regulation of T cell homeostatic proliferation	IEA
GO:0048304	Process	Positive regulation of isotype switching to IgG isotypes	IEA
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:1900100	Process	Positive regulation of plasma cell differentiation	IGI	22962438
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA

Other IDs

• MIM: 147680
• HGNC: 6001
• e!Ensembl: ENSG00000109471

Protein

• UniProt ID: P60568
• Protein name: Interleukin-2 (IL-2) (T-cell growth factor) (TCGF) (Aldesleukin)
• Protein function: Cytokine produced by activated CD4-positive helper T-cells and to a lesser extend activated CD8-positive T-cells and natural killer (NK) cells that plays pivotal roles in the immune response and tolerance (PubMed:6438535). Binds to a receptor co
• PDB: 1IRL, 1M47, 1M48, 1M49, 1M4A, 1M4B, 1M4C, 1NBP, 1PW6, 1PY2, 1QVN, 1Z92, 2B5I, 2ERJ, 3INK, 3QAZ, 3QB1, 4NEJ, 4NEM, 5LQB, 5M5E, 5UTZ, 6LX3, 6LXW, 6VWU, 6YE3, 7DR4, 7M2G, 7RA9, 7RAA, 7YZJ, 7ZMZ, 8SOW, 8SOZ, 8WYR, 8WYS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00715	IL2	7 → 150	Interleukin 2	Domain

• Sequence:

  MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
  TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
  TTFMCEYADETATIVEFLNRWITFCQSIISTLT

• Sequence length: 153

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
PI3K-Akt signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Yersinia infection
Chagas disease
Measles
Human T-cell leukemia virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Autoimmune thyroid disease
Inflammatory bowel disease
Allograft rejection
Graft-versus-host disease

Reactome:

RAF/MAP kinase cascade
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Interleukin-2 signaling
Interleukin receptor SHC signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505	7678812
Asthma	Childhood asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	31036433
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	18929414, 16360218
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	22245253, 11312644
Glioblastoma	Glioblastoma, Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888	7719933
Glomerulonephritis	Glomerulonephritis	rs778043831	10910440, 9403216
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	17500047
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	18625569, 7614408, 18298334
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	16260693, 15917704, 15577323, 18176117, 16939954, 17023156, 17709802, 16131448, 19243244, 16432458, 12374674, 12439608, 18999936, 17761969, 20423231, 18281670, 18332650, 17105418, 18298334, 17576460, 16809738, 16248763
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391	19242727
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17115417
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	23487197, 20926141, 24564241

Unknown
Disease name	Disease term	dbSNP ID	References
Amnesia	Amnesia		8241462
Anorexia	Anorexia		8635092
Benign neoplasm	Benign Neoplasm		12579325
Urinary bladder cancer	Malignant neoplasm of urinary bladder		1949363, 3495671
Bladder neoplasm	Bladder Neoplasm		3495671, 1949363
Brain neoplasms	Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain	rs1800720, rs587781720	6319491
Bright disease	Bright Disease		10910440, 9403216
Intracranial neoplasm	Neoplasms, Intracranial		6319491
Celiac disease	Celiac Disease	rs2305764, rs35218876	25920553
Autoimmune hepatitis	Autoimmune Chronic Hepatitis		21227906
Giant cell glioblastoma	Giant Cell Glioblastoma		7719933
Involutional depression	Involutional Depression		12635532
Involutional paraphrenia	Involutional paraphrenia		12635532
Kidney neoplasm	Kidney Neoplasm		18298334, 19409039, 18625569, 17105418
Kidney cancer	Malignant neoplasm of kidney		18625569, 18298334, 19409039, 17105418
Leukopenia	Leukopenia		7678812
Liver neoplasms	Liver neoplasms		18298334
Liver cancer	Malignant neoplasm of liver		18298334
Lung neoplasms	Lung Neoplasms		7614408, 18298334, 18625569
Malignant neoplasm	Malignant Neoplasms		12579325
Malignant vaginal neoplasm	Malignant Vaginal Neoplasm		15577323
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	12635532
Neoplasms	Neoplasms		12579325
Paranoid schizophrenia	Paranoid Schizophrenia		23487197
Prostatic neoplasms	Prostatic Neoplasms		17115417
Psychosis	Psychosis, Involutional		12635532
Residual tumor	Residual Tumor		14654953
T-cell lymphoma/leukemia	Adult T-Cell Lymphoma/Leukemia		23962110
Vaginal neoplasms	Vaginal Neoplasms		15577323