KLK3 (kallikrein related peptidase 3)

Gene

• Entrez ID: 354
• Gene name: Kallikrein related peptidase 3
• Gene symbol: KLK3
• Synonyms: APS, KLK2A1, PSA, hK3
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017222	hsa-miR-335-5p	Microarray	18185580
MIRT1099048	hsa-miR-3150a-3p	CLIP-seq
MIRT1099049	hsa-miR-3175	CLIP-seq
MIRT1099050	hsa-miR-4514	CLIP-seq
MIRT1099051	hsa-miR-4645-5p	CLIP-seq
MIRT1099052	hsa-miR-4673	CLIP-seq
MIRT1099053	hsa-miR-4692	CLIP-seq
MIRT1099054	hsa-miR-939	CLIP-seq
MIRT2390004	hsa-miR-4268	CLIP-seq
MIRT2390005	hsa-miR-4717-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AATF	Unknown	23146908
AR	Activation	10547578;11006269;11504717;11571582;12958311;16425097;16434977;16724108;17566103;20069563;21780100;22179832;23667504;8626436
AR	Repression	16342680;9316650
AR	Unknown	11059779;11238180;11532861;12376473;12539223;12648523;12651911;15368351;15543614;15557561;15640095;17011549;17075604;17094454;17426252;17433535;18780293;18829551;19274665;21308712;21981678;22245379;22473899;23884959;24307657;7514587;9052414;9211894
AR	Unknown	24937452
BTG2	Repression	21172304
EGR1	Repression	15517885
EP300	Unknown	23884959
FOXP1	Repression	18640093
FUS	Unknown	21909421
HIF1A	Unknown	23884959
NCOA4	Activation	18649734
NFKB1	Activation	11909978
NFKB1	Repression	15517885
NKX3-1	Unknown	17483333
PA2G4	Repression	16254079
PGR	Unknown	9052414
REL	Unknown	17011549
RELA	Repression	15517885
RREB1	Repression	17550981
RUNX1	Unknown	16237704
RUNX2	Unknown	16237704
SIN3A	Repression	16254079
SP1	Activation	15708372
SP3	Activation	15708372
SPDEF	Unknown	16237704;17483333
SRCAP	Activation	20432434
TRPS1	Unknown	14680804
WT1	Unknown	18631392

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002778	Process	Antibacterial peptide production	IDA	18714013
GO:0003073	Process	Regulation of systemic arterial blood pressure	IBA	21873635
GO:0004175	Function	Endopeptidase activity	IDA	18714013
GO:0004252	Function	Serine-type endopeptidase activity	IMP	15563730
GO:0005515	Function	Protein binding	IPI	1725227, 8665956, 19345326, 25241761
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8665956
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006508	Process	Proteolysis	IMP	15563730
GO:0008236	Function	Serine-type peptidase activity	TAS	2470553
GO:0016525	Process	Negative regulation of angiogenesis	NAS	10675891
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IMP	8665956
GO:0030141	Component	Secretory granule	IBA	21873635
GO:0031638	Process	Zymogen activation	IBA	21873635
GO:0032991	Component	Protein-containing complex	IDA	8665956
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 176820
• HGNC: 6364
• e!Ensembl: ENSG00000142515

Protein

• UniProt ID: P07288
• Protein name: Prostate-specific antigen (PSA) (EC 3.4.21.77) (Gamma-seminoprotein) (Seminin) (Kallikrein-3) (P-30 antigen) (Semenogelase)
• Protein function: Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
• PDB: 2ZCH, 2ZCK, 2ZCL, 3QUM, 9F1I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	25 → 253	Trypsin	Domain

• Sequence:

  MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
  LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
  LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
  NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
  SLYTKVVHYRKWIKDTIVANP

• Sequence length: 261

Pathways

KEGG:

Pathways in cancer
Prostate cancer

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	23040885
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18676866, 18264097, 12644816, 17148459, 16984552, 17003774, 15790600, 27318894, 18500220, 16442593, 24753544, 16424004, 24753544, 24740154, 25939597

Unknown
Disease name	Disease term	dbSNP ID	References
Benign prostatic hyperplasia	Benign Prostatic Hyperplasia		21128595
Malignant prostate phyllodes tumor	Malignant Phyllodes Tumor of Prostate		22360509
Prostatic neoplasms	Prostatic Neoplasms		17148459, 17003774, 15790600, 27318894, 18676866, 18264097, 16442593, 18500220, 16984552, 12644816, 16424004
Prostatic adenoma	Prostatic Adenoma		21128595
Prostatic hyperplasia	Prostatic Hyperplasia		21128595
Prostatic hypertrophy	Prostatic Hypertrophy		21128595