GediPNet logo

RBPJ (recombination signal binding protein for immunoglobulin kappa J region)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3516
Gene nameGene Name - the full gene name approved by the HGNC.
Recombination signal binding protein for immunoglobulin kappa J region
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
RBPJ
SynonymsGene synonyms aliases
AOS3, CBF-1, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBP-J kappa, RBP-JK, RBPJK, RBPSUH, SUH, csl
ChromosomeChromosome number
4
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387907270 A>G Pathogenic Coding sequence variant, missense variant
rs387907271 A>G Pathogenic Coding sequence variant, missense variant
rs1064794801 CTACTGCAGTGGA>- Likely-pathogenic Coding sequence variant, splice acceptor variant, intron variant
rs1553878198 C>G Likely-pathogenic Coding sequence variant, missense variant
rs1553878211 A>G Likely-pathogenic Coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019785 hsa-miR-375 Microarray 20215506
MIRT020670 hsa-miR-155-5p Proteomics 18668040
MIRT022527 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT052218 hsa-let-7b-5p CLASH 23622248
MIRT050652 hsa-miR-18a-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18663143
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 16691198
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q06330
Protein name Recombining binding protein suppressor of hairless (CBF-1) (J kappa-recombination signal-binding protein) (RBP-J kappa) (RBP-J) (RBP-JK) (Renal carcinoma antigen NY-REN-30)
Protein function Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not assoc
PDB 2F8X , 3NBN , 3V79 , 6PY8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09271 LAG1-DNAbind
48 178
LAG1, DNA binding
Domain
PF09270 BTD
206 328
Beta-trefoil DNA-binding domain
Domain
Sequence
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNAD
LC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASW
TIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Sequence length 500
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Notch signaling pathway
Th1 and Th2 cell differentiation
Spinocerebellar ataxia
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
  Pre-NOTCH Transcription and Translation
NOTCH1 Intracellular Domain Regulates Transcription
NOTCH2 intracellular domain regulates transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway
RUNX3 regulates NOTCH signaling
NOTCH3 Intracellular Domain Regulates Transcription
NOTCH4 Intracellular Domain Regulates Transcription
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Adams-oliver syndrome Adams Oliver syndrome, ADAMS-OLIVER SYNDROME 3, Adams-Oliver syndrome 1, Adams-Oliver syndrome rs41309764, rs387907031, rs1559999373, rs1226716539, rs387907270, rs387907271, rs397509398, rs397509399, rs587776993, rs587776994, rs587776995, rs587781259, rs587777735, rs587777736, rs730882238, rs796065350, rs796065348, rs796065351, rs796065347, rs796065346, rs796065345, rs796065344, rs61750844, rs864622063, rs864622061, rs746342893, rs864622060, rs864622059, rs864622058, rs864622057, rs864622056, rs869025494, rs879255610, rs201387914, rs1057523819, rs1555697020, rs372751467, rs374530179, rs1348892740, rs1280482569, rs1555826472, rs1553768038, rs185181819, rs1247059195, rs369583084, rs771160630, rs1553878211, rs1553880029, rs1553882550, rs1554727954, rs587778569, rs1554728424, rs1554729113, rs1554729443, rs1554730184, rs1554730670, rs1555393027, rs1555393125, rs1247027543, rs1555393182, rs1554729118, rs1554728428, rs1559604548, rs1564199476, rs1564191302, rs752015120, rs1589058964, rs1589072024, rs1596194950, rs1589064285, rs1843317673 22883147, 28160419, 29924900, 22883147, 22883147, 28160419
Aplasia cutis congenita Aplasia Cutis Congenita, Congenital defect of skull and scalp rs587777706
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852, rs121917853, rs121917854, rs121917855, rs121917859, rs121917861, rs267606873, rs267606872, rs267606985, rs267606986, rs267606987, rs267606988, rs28933082, rs397514519, rs869025613, rs869025614, rs886039878, rs1553540620, rs1057518333, rs1948841937, rs1948868228, rs1948842030, rs1948842142
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322, rs121917775, rs121917735, rs121917736, rs137853199, rs137853200, rs121917867, rs121917869, rs121913555, rs104893736, rs121909595, rs121909596, rs121909597, rs28931605, rs121909598, rs104893618, rs1695062782, rs74315486, rs74315487, rs74315490, rs74315489, rs745938679, rs1566402656, rs74315439, rs74315441, rs121912973, rs121917823, rs1593332981, rs121917825, rs121917827, rs113994108, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs750207077, rs387907336, rs387907337, rs387907342, rs140332366, rs397514703, rs398122937, rs398122378, rs398122392, rs398122944, rs137853924, rs398122947, rs397515623, rs397515624, rs397515625, rs397515626, rs398122948, rs587778872, rs398123066, rs587777601, rs370424081, rs786205221, rs786205222, rs864309684, rs864309688, rs864309701, rs864309689, rs864309690, rs864309681, rs864309686, rs864309696, rs864309693, rs864309687, rs864309691, rs864309692, rs864309695, rs864309678, rs864309685, rs864309700, rs864309698, rs864309683, rs864309682, rs864309679, rs111534978, rs864309680, rs864309702, rs864622780, rs756898971, rs869312732, rs775038545, rs878852983, rs1114167312, rs1114167313, rs1114167314, rs1114167315, rs1114167307, rs886041410, rs886041412, rs1057518738, rs1057517926, rs1057518878, rs1057519616, rs12799308, rs1064793935, rs1064797219, rs1085307126, rs1085307127, rs765628635, rs1114167427, rs1114167433, rs1554744860, rs1554743428, rs747093432, rs1411557416, rs1555179713, rs1481963503, rs1555549755, rs1456161420, rs1555547008, rs1555889308, rs1555888762, rs766522434, rs1264025914, rs1553585262, rs1567671947, rs1337897299, rs764945940, rs1307969607, rs949335475, rs1184095219, rs776129797, rs1569203234, rs1567668570, rs749141857, rs764098604, rs1184398243, rs1578956689, rs1568480054, rs1564745688, rs1564722302, rs1564723150, rs1571175950, rs1569602837, rs1576552712, rs1575369255, rs981126461, rs1570403798, rs200557771, rs1477743112, rs1651879427, rs1651881222, rs1651919374, rs2024441691, rs148284531, rs1246080692
Unknown
Disease name Disease term dbSNP ID References
Acquired porencephaly Acquired porencephaly
Alopecia Alopecia
Cirrhosis Cirrhosis rs119465999, rs144369314, rs8056684, rs112053857, rs75998507
Congenital arteriovenous malformation Congenital arteriovenous malformation

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412