IGFBP6 (insulin like growth factor binding protein 6)

Gene

• Entrez ID: 3489
• Gene name: Insulin like growth factor binding protein 6
• Gene symbol: IGFBP6
• Synonyms: IBP6
• Chromosome: 12
• Chromosome location: 12q13.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2429972	hsa-miR-145	CLIP-seq
MIRT2429973	hsa-miR-1825	CLIP-seq
MIRT2429974	hsa-miR-199a-5p	CLIP-seq
MIRT2429975	hsa-miR-199b-5p	CLIP-seq
MIRT2429976	hsa-miR-3667-3p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550587	hsa-miR-129-5p	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2550599	hsa-miR-4512	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550601	hsa-miR-4658	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550604	hsa-miR-4758-5p	CLIP-seq
MIRT2550605	hsa-miR-4765	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550607	hsa-miR-653	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq
MIRT2550588	hsa-miR-1908	CLIP-seq
MIRT2550589	hsa-miR-2277-3p	CLIP-seq
MIRT2550590	hsa-miR-2861	CLIP-seq
MIRT2437781	hsa-miR-3124-3p	CLIP-seq
MIRT2550591	hsa-miR-3165	CLIP-seq
MIRT2550592	hsa-miR-3180	CLIP-seq
MIRT2550593	hsa-miR-3180-3p	CLIP-seq
MIRT2550594	hsa-miR-3184	CLIP-seq
MIRT2550595	hsa-miR-3196	CLIP-seq
MIRT2437782	hsa-miR-3591-3p	CLIP-seq
MIRT2550596	hsa-miR-3616-3p	CLIP-seq
MIRT2550597	hsa-miR-3675-5p	CLIP-seq
MIRT2550598	hsa-miR-423-5p	CLIP-seq
MIRT2429977	hsa-miR-4326	CLIP-seq
MIRT2550600	hsa-miR-4641	CLIP-seq
MIRT2550602	hsa-miR-4710	CLIP-seq
MIRT2429978	hsa-miR-4716-5p	CLIP-seq
MIRT2550603	hsa-miR-4721	CLIP-seq
MIRT2550606	hsa-miR-493	CLIP-seq
MIRT2550608	hsa-miR-663	CLIP-seq
MIRT2550609	hsa-miR-744	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IDA	24003225
GO:0001968	Function	Fibronectin binding	IBA	21873635
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	24003225, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005794	Component	Golgi apparatus	IEA
GO:0007165	Process	Signal transduction	NAS	10087296
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7539002
GO:0016477	Process	Cell migration	IDA	24003225
GO:0031994	Function	Insulin-like growth factor I binding	IBA	21873635
GO:0031995	Function	Insulin-like growth factor II binding	IBA	21873635
GO:0031995	Function	Insulin-like growth factor II binding	IMP	15308688
GO:0042568	Component	Insulin-like growth factor binary complex	IMP	15308688
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA	21873635
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302

Other IDs

• MIM: 146735
• HGNC: 5475
• e!Ensembl: ENSG00000167779

Protein

• UniProt ID: P24592
• Protein name: Insulin-like growth factor-binding protein 6 (IBP-6) (IGF-binding protein 6) (IGFBP-6)
• Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates t
• PDB: 1RMJ, 2JM2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00086	Thyroglobulin_1	163 → 234	Thyroglobulin type-1 repeat	Domain

• Sequence:

  MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
  EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
  KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
  GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
  

• Sequence length: 240

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	15846301

Unknown
Disease name	Disease term	dbSNP ID	References
Endometrioma	Endometrioma		21063030
Endometriosis	Endometriosis	rs1800629, rs1143634	21063030
Miscarriage	Miscarriage		18539642
Prostatic neoplasms	Prostatic Neoplasms		15846301
Respiratory distress syndrome	Respiratory Distress Syndrome, Adult		25070658