IGFBP2 (insulin like growth factor binding protein 2)

Gene

• Entrez ID: 3485
• Gene name: Insulin like growth factor binding protein 2
• Gene symbol: IGFBP2
• Synonyms: IBP2, IGF-BP53
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can rema

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT006543	hsa-miR-126-3p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22170610
MIRT017411	hsa-miR-335-5p	Microarray	18185580
MIRT732358	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	27487563
MIRT732358	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR	27487563
MIRT1549915	hsa-miR-1250	CLIP-seq
MIRT1549916	hsa-miR-138	CLIP-seq
MIRT1549917	hsa-miR-3124-3p	CLIP-seq
MIRT1549918	hsa-miR-3148	CLIP-seq
MIRT1549919	hsa-miR-3663-5p	CLIP-seq
MIRT1549920	hsa-miR-4668-3p	CLIP-seq
MIRT1549921	hsa-miR-4753-3p	CLIP-seq
MIRT1549922	hsa-miR-592	CLIP-seq
MIRT1549923	hsa-miR-597	CLIP-seq
MIRT1549924	hsa-miR-875-3p	CLIP-seq
MIRT2014664	hsa-miR-3065-3p	CLIP-seq
MIRT1549918	hsa-miR-3148	CLIP-seq
MIRT2014665	hsa-miR-338-3p	CLIP-seq
MIRT2014666	hsa-miR-3667-3p	CLIP-seq
MIRT2014667	hsa-miR-4530	CLIP-seq
MIRT2014668	hsa-miR-4640-3p	CLIP-seq
MIRT1549920	hsa-miR-4668-3p	CLIP-seq
MIRT2014669	hsa-miR-4691-5p	CLIP-seq
MIRT1549921	hsa-miR-4753-3p	CLIP-seq
MIRT2014670	hsa-miR-766	CLIP-seq
MIRT1549924	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	19095771
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	15694994
GO:0007165	Process	Signal transduction	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007568	Process	Aging	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0010226	Process	Response to lithium ion	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IBA	21873635
GO:0031994	Function	Insulin-like growth factor I binding	IDA	19081843
GO:0031995	Function	Insulin-like growth factor II binding	IBA	21873635
GO:0031995	Function	Insulin-like growth factor II binding	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	15694994
GO:0042493	Process	Response to drug	IEA
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA	21873635
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IC	19081843
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	ISS
GO:0043627	Process	Response to estrogen	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302

Other IDs

• MIM: 146731
• HGNC: 5471
• e!Ensembl: ENSG00000115457

Protein

• UniProt ID: P18065
• Protein name: Insulin-like growth factor-binding protein 2 (IBP-2) (IGF-binding protein 2) (IGFBP-2)
• Protein function: Multifunctional protein that plays a critical role in regulating the availability of IGFs such as IGF1 and IGF2 to their receptors and thereby regulates IGF-mediated cellular processes including proliferation, differentiation, and apoptosis in a
• PDB: 2H7T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	42 → 111	Insulin-like growth factor binding protein	Domain
  PF00086	Thyroglobulin_1	227 → 306	Thyroglobulin type-1 repeat	Domain

• Sequence:

  MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
  PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
  LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
  LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
  MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
  RGDPECHLFYNEQQEARGVHTQRMQ

• Sequence length: 325

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenoid Cystic Carcinoma	rs121913530, rs886039394, rs121913474	16762588
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	22537059

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		15762851, 17395163, 17230047
Liver cirrhosis	Liver Cirrhosis		26396155
Liver fibrosis	Fibrosis, Liver		26396155
Salivary gland neoplasm	Salivary Gland Neoplasms		16762588
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland		16762588