IGFBP1 (insulin like growth factor binding protein 1)

Gene

• Entrez ID: 3484
• Gene name: Insulin like growth factor binding protein 1
• Gene symbol: IGFBP1
• Synonyms: AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1
• Chromosome: 7
• Chromosome location: 7p12.3
• Summary: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006386	hsa-miR-29c-3p	Luciferase reporter assay	21436257
MIRT022268	hsa-miR-124-3p	Microarray	18668037
MIRT707553	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707554	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707555	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707556	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT707557	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT707558	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT731948	hsa-miR-542-3p	Luciferase reporter assay	28051155

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	16687408
ETS1	Unknown	21401636
EZH2	Unknown	21903722
FOXO1	Activation	15200677
FOXO1	Repression	15987820
FOXO1	Unknown	21401636;23603247
HDAC9	Repression	12609987
HNF1A	Activation	7684229
HOXA10	Activation	15200677;20478621
PGR	Unknown	11117526;15987820
PPARA	Unknown	20110263
SP1	Unknown	2849945
SP3	Unknown	8776721
WWTR1	Unknown	20164440

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	24431302
GO:0005515	Function	Protein binding	IPI	16924115, 22578544, 26091039, 32814053
GO:0005520	Function	Insulin-like growth factor binding	TAS	2454104
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0007165	Process	Signal transduction	TAS	2454104
GO:0007568	Process	Aging	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031994	Function	Insulin-like growth factor I binding	IBA	21873635
GO:0031994	Function	Insulin-like growth factor I binding	IDA	21550830
GO:0031995	Function	Insulin-like growth factor II binding	IBA	21873635
GO:0031995	Function	Insulin-like growth factor II binding	IDA	21550830
GO:0036499	Process	PERK-mediated unfolded protein response	TAS
GO:0042246	Process	Tissue regeneration	IEA
GO:0043567	Process	Regulation of insulin-like growth factor receptor signaling pathway	IBA	21873635
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS	24431302

Other IDs

• MIM: 146730
• HGNC: 5469
• e!Ensembl: ENSG00000146678

Protein

• UniProt ID: P08833
• Protein name: Insulin-like growth factor-binding protein 1 (IBP-1) (IGF-binding protein 1) (IGFBP-1) (Placental protein 12) (PP12)
• Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
• PDB: 1ZT3, 1ZT5, 2DSQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	30 → 84	Insulin-like growth factor binding protein	Domain
  PF00086	Thyroglobulin_1	176 → 251	Thyroglobulin type-1 repeat	Domain

• Sequence:

  MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
  PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
  PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
  YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
  GSPEIRGDPNCQIYFNVQN

• Sequence length: 259

Pathways

Reactome:

ATF4 activates genes in response to endoplasmic reticulum stress
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925

Unknown
Disease name	Disease term	dbSNP ID	References
Endometriosis	Endometriosis	rs1800629, rs-1, rs1143634	20864642
Biliary cirrhosis	Biliary cirrhosis, Biliary Cirrhosis, Primary, 1, Primary biliary cirrhosis		18422935
Endometrioma	Endometrioma		20864642
Kidney failure	Kidney Failure, Acute		7540432
Liver cirrhosis	Liver Cirrhosis		26396155
Liver fibrosis	Fibrosis, Liver		26396155
Miscarriage	Miscarriage		18539642
Acute kidney insufficiency	Acute Kidney Insufficiency		7540432
Russell-silver syndrome	Russell-Silver syndrome		10364674
Biliary cholangitis	Secondary Biliary Cholangitis		18422935