APOD (apolipoprotein D)

Gene

• Entrez ID: 347
• Gene name: Apolipoprotein D
• Gene symbol: APOD
• Synonyms: -
• Chromosome: 3
• Chromosome location: 3q29
• Summary: This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamil

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT790044	hsa-miR-214	CLIP-seq
MIRT790045	hsa-miR-3619-5p	CLIP-seq
MIRT790046	hsa-miR-3622b-5p	CLIP-seq
MIRT790047	hsa-miR-409-5p	CLIP-seq
MIRT790048	hsa-miR-4253	CLIP-seq
MIRT790049	hsa-miR-4436b-3p	CLIP-seq
MIRT790050	hsa-miR-4666-5p	CLIP-seq
MIRT790051	hsa-miR-4761-3p	CLIP-seq
MIRT790052	hsa-miR-545	CLIP-seq
MIRT790053	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NOTCH3	Repression	21705670

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IBA	21873635
GO:0000302	Process	Response to reactive oxygen species	IDA	18419796
GO:0001525	Process	Angiogenesis	NAS	21705670
GO:0005319	Function	Lipid transporter activity	NAS	3453108
GO:0005515	Function	Protein binding	IPI	7918467, 25416956, 25910212, 31515488, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	HDA	16502470, 20551380
GO:0005615	Component	Extracellular space	IDA	21705670
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	IDA	19176353
GO:0006629	Process	Lipid metabolic process	IBA	21873635
GO:0006629	Process	Lipid metabolic process	IDA	19176353
GO:0006869	Process	Lipid transport	IEA
GO:0007420	Process	Brain development	ISS
GO:0007568	Process	Aging	NAS	20023409
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	14551159
GO:0014012	Process	Peripheral nervous system axon regeneration	ISS
GO:0015485	Function	Cholesterol binding	IBA	21873635
GO:0015485	Function	Cholesterol binding	IDA	9278274
GO:0022626	Component	Cytosolic ribosome	ISS
GO:0030425	Component	Dendrite	ISS
GO:0042246	Process	Tissue regeneration	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IDA	14551159
GO:0042493	Process	Response to drug	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14551159
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	14551159
GO:0048678	Process	Response to axon injury	ISS
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	21705670
GO:0060588	Process	Negative regulation of lipoprotein lipid oxidation	IDA	18419796
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071638	Process	Negative regulation of monocyte chemotactic protein-1 production	IDA	18842892
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	18842892
GO:2000098	Process	Negative regulation of smooth muscle cell-matrix adhesion	IMP	21705670
GO:2000405	Process	Negative regulation of T cell migration	IDA	18842892

Other IDs

• MIM: 107740
• HGNC: 612
• e!Ensembl: ENSG00000189058

Protein

• UniProt ID: P05090
• Protein name: Apolipoprotein D (Apo-D) (ApoD)
• Protein function: APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
• PDB: 2HZQ, 2HZR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	43 → 184	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR
  CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI
  LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT
  DQVNCPKLS

• Sequence length: 189

Pathways

Reactome:

Transport of fatty acids
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Glioma	Glioma, mixed gliomas, Malignant Glioma	rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701	16865689
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	14623496, 16402085, 16966838

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		14623496
Degenerative diseases, central nervous system	Degenerative Diseases, Central Nervous System, Degenerative Diseases, Spinal Cord		18458334
Learning disorders	Learning Disorders, Adult Learning Disorders, Learning Disturbance, Learning Disabilities		18419796
Neurodegenerative disorders	Neurodegenerative Disorders		18458334