LINC00299 (long intergenic non-protein coding RNA 299)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
339789 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Long intergenic non-protein coding RNA 299 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
LINC00299 |
SynonymsGene synonyms aliases
|
C2orf46, LINC00298, LINC01814, NCRNA00299 |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2p25.1 |
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q6ZSB3 |
Protein name |
Putative uncharacterized protein encoded by LINC00299 |
Family and domains |
|
Sequence |
MVQREKARDNFEGGCLAELIGSPRDWKCFLAVPDPLLGVQHWLHLWRPQTKDGNSLHRHG DQAWGKHRRQNSLKSPALSGHSIDYHFYPRLRCGMLIGPDKQAVASGLEVLVTSSTKILG QLFPDAAHFLEEASEFKAE
|
|
Sequence length |
139 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Asthma |
Asthma, Childhood asthma |
rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 |
27182965, 29785011, 30929738, 31619474, 30929738, 31036433 |
Dermatitis |
Dermatitis, Atopic |
rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 |
26482879 |
Hypothyroidism |
Hypothyroidism |
rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605 |
30595370 |
Prostate cancer |
Prostate carcinoma |
rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 |
29892016 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Allergic rhinitis |
Allergic rhinitis (disorder) |
|
30013184 |
Eczema |
Eczema |
|
30595370 |
Respiratory tract diseases |
Respiratory Tract Diseases |
|
30595370 |
|
|
|
| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412 |