ID1 (inhibitor of DNA binding 1)

Gene

• Entrez ID: 3397
• Gene name: Inhibitor of DNA binding 1
• Gene symbol: ID1
• Synonyms: ID, bHLHb24
• Chromosome: 20
• Chromosome location: 20q11.21
• Summary: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and tr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003418	hsa-miR-100-5p	Microarray, qRT-PCR	19396866
MIRT004739	hsa-miR-520h	Microarray, qRT-PCR	19435428
MIRT022546	hsa-miR-124-3p	Microarray	18668037
MIRT024947	hsa-miR-215-5p	Microarray	19074876
MIRT026397	hsa-miR-192-5p	Microarray	19074876
MIRT029333	hsa-miR-26b-5p	Microarray	19088304
MIRT052982	hsa-miR-381-3p	Luciferase reporter assay, qRT-PCR, Western blot	22592211
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT052982	hsa-miR-381-3p	HITS-CLIP	24374217
MIRT439157	hsa-let-7c-5p	3'LIFE	25074381
MIRT736667	hsa-miR-338-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31646712
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT1058949	hsa-miR-2054	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT1058953	hsa-miR-300	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT736667	hsa-miR-338-5p	CLIP-seq
MIRT1058956	hsa-miR-381	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT1058958	hsa-miR-4289	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT1058960	hsa-miR-4666-3p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT1058964	hsa-miR-2355-5p	CLIP-seq
MIRT1058965	hsa-miR-3127-3p	CLIP-seq
MIRT1058966	hsa-miR-4313	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT1058947	hsa-miR-1238	CLIP-seq
MIRT1058948	hsa-miR-1253	CLIP-seq
MIRT2245849	hsa-miR-1275	CLIP-seq
MIRT2437683	hsa-miR-1287	CLIP-seq
MIRT2245850	hsa-miR-2117	CLIP-seq
MIRT1058950	hsa-miR-29a	CLIP-seq
MIRT1058951	hsa-miR-29b	CLIP-seq
MIRT1058952	hsa-miR-29c	CLIP-seq
MIRT2245851	hsa-miR-3175	CLIP-seq
MIRT2245852	hsa-miR-3197	CLIP-seq
MIRT1058954	hsa-miR-3200-5p	CLIP-seq
MIRT1058955	hsa-miR-330-3p	CLIP-seq
MIRT2437684	hsa-miR-3652	CLIP-seq
MIRT2437685	hsa-miR-3677-5p	CLIP-seq
MIRT1058957	hsa-miR-4251	CLIP-seq
MIRT2245853	hsa-miR-4273	CLIP-seq
MIRT2245854	hsa-miR-4285	CLIP-seq
MIRT2245855	hsa-miR-4287	CLIP-seq
MIRT2437686	hsa-miR-4323	CLIP-seq
MIRT1058959	hsa-miR-4329	CLIP-seq
MIRT2245856	hsa-miR-4330	CLIP-seq
MIRT2437687	hsa-miR-4430	CLIP-seq
MIRT2245857	hsa-miR-4469	CLIP-seq
MIRT2245858	hsa-miR-4525	CLIP-seq
MIRT2245859	hsa-miR-4665-5p	CLIP-seq
MIRT2245860	hsa-miR-4677-5p	CLIP-seq
MIRT2245861	hsa-miR-4685-3p	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2245862	hsa-miR-4713-5p	CLIP-seq
MIRT2245863	hsa-miR-4723-5p	CLIP-seq
MIRT1058961	hsa-miR-520d-5p	CLIP-seq
MIRT1058962	hsa-miR-524-5p	CLIP-seq
MIRT1058963	hsa-miR-591	CLIP-seq
MIRT2245864	hsa-miR-625	CLIP-seq
MIRT2451577	hsa-miR-1825	CLIP-seq
MIRT2451578	hsa-miR-4279	CLIP-seq
MIRT2437688	hsa-miR-4690-3p	CLIP-seq
MIRT2451579	hsa-miR-515-3p	CLIP-seq
MIRT2451580	hsa-miR-519e	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Repression	20565867
ATF5	Repression	18701499
CEBPA	Unknown	22568493
POU2F1	Unknown	19212692
TP53	Unknown	16557594
TRIM28	Unknown	21876767
WHSC1	Unknown	16115125
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7665172
GO:0001525	Process	Angiogenesis	TAS	14522471
GO:0005515	Function	Protein binding	IPI	15694377, 17855368, 20861012, 21988832, 25609649, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	14522471
GO:0007420	Process	Brain development	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008134	Function	Transcription factor binding	IEA
GO:0010621	Process	Negative regulation of transcription by transcription factor localization	TAS	14522471
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030182	Process	Neuron differentiation	IEA
GO:0032091	Process	Negative regulation of protein binding	IEA
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA	21873635
GO:0036164	Process	Cell-abiotic substrate adhesion	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043392	Process	Negative regulation of DNA binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	7665172
GO:0043534	Process	Blood vessel endothelial cell migration	TAS	14522471
GO:0045602	Process	Negative regulation of endothelial cell differentiation	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	15138269
GO:0046983	Function	Protein dimerization activity	IEA
GO:0047485	Function	Protein N-terminus binding	IEA
GO:0048514	Process	Blood vessel morphogenesis	TAS	14522471
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050774	Process	Negative regulation of dendrite morphogenesis	IEA
GO:0070628	Function	Proteasome binding	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	28270523
GO:0140110	Function	Transcription regulator activity	IBA	21873635
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	7665172
GO:1901342	Process	Regulation of vasculature development	IEA
GO:1901653	Process	Cellular response to peptide	IEA
GO:1903351	Process	Cellular response to dopamine	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA

Other IDs

• MIM: 600349
• HGNC: 5360
• e!Ensembl: ENSG00000125968

Protein

• UniProt ID: P41134
• Protein name: DNA-binding protein inhibitor ID-1 (Class B basic helix-loop-helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)
• Protein function: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	66 → 106	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
  QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
  RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

• Sequence length: 155

Pathways

KEGG:

Rap1 signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells

Reactome:

Oncogene Induced Senescence
NGF-stimulated transcription

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	16123366

Unknown
Disease name	Disease term	dbSNP ID	References
Benign neoplasm	Benign Neoplasm		16966095
Malignant neoplasm	Malignant Neoplasms		16966095
Myocardial ischemia	Myocardial Ischemia		16214533
Neoplasms	Neoplasms		16966095