HTR6 (5-hydroxytryptamine receptor 6)

Gene

• Entrez ID: 3362
• Gene name: 5-hydroxytryptamine receptor 6
• Gene symbol: HTR6
• Synonyms: 5-HT6, 5-HT6R
• Chromosome: 1
• Chromosome location: 1p36.13
• Summary: This gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathwa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq
MIRT2013104	hsa-miR-1182	CLIP-seq
MIRT2245381	hsa-miR-1266	CLIP-seq
MIRT2245382	hsa-miR-4518	CLIP-seq
MIRT2245383	hsa-miR-510	CLIP-seq
MIRT2013105	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004969	Function	Histamine receptor activity	TAS	8522988
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	17189269, 23027611, 24614691, 30853821
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005929	Component	Cilium	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0021795	Process	Cerebral cortex cell migration	ISS
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0032008	Process	Positive regulation of TOR signaling	IDA	23027611
GO:0045202	Component	Synapse	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA

Other IDs

• MIM: 601109
• HGNC: 5301
• e!Ensembl: ENSG00000158748

Protein

• UniProt ID: P50406
• Protein name: 5-hydroxytryptamine receptor 6 (5-HT-6) (5-HT6) (Serotonin receptor 6)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:36989299, PubMed:37327704, PubMed:8522988). Also has a high affinity for tr
• PDB: 7XTB, 7YS6, 8JLZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	43 → 320	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
  SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
  SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
  RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
  RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
  LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
  RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
  FNIDPAEPELRPHPLGIPTN

• Sequence length: 440

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse

Reactome:

Serotonin receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	12165372

Unknown
Disease name	Disease term	dbSNP ID	References
Memory disorders	Memory Disorders		19733250
Age-related memory disorders	Age-Related Memory Disorders		19733250
Mood disorder	Mood Disorders		20394784, 18206183, 10581475