HTR3A (5-hydroxytryptamine receptor 3A)

Gene

• Entrez ID: 3359
• Gene name: 5-hydroxytryptamine receptor 3A
• Gene symbol: HTR3A
• Synonyms: 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
• Chromosome: 11
• Chromosome location: 11q23.2
• Summary: The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021413	hsa-miR-9-5p	Microarray	17612493
MIRT1057238	hsa-miR-3160-3p	CLIP-seq
MIRT1057239	hsa-miR-4307	CLIP-seq
MIRT1057240	hsa-miR-4487	CLIP-seq
MIRT1057241	hsa-miR-4710	CLIP-seq
MIRT1057242	hsa-miR-4792	CLIP-seq
MIRT1057243	hsa-miR-558	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IBA	21873635
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IDA	7565620, 9950429
GO:0030424	Component	Axon	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0032154	Component	Cleavage furrow	IDA	19799413
GO:0032414	Process	Positive regulation of ion transmembrane transporter activity	IEA
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042220	Process	Response to cocaine	IEA
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043025	Component	Neuronal cell body	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0045471	Process	Response to ethanol	IEA
GO:0050877	Process	Nervous system process	IBA	21873635
GO:0051378	Function	Serotonin binding	IDA	7565620
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IDA	9950429

Other IDs

• MIM: 182139
• HGNC: 5297
• e!Ensembl: ENSG00000166736

Protein

• UniProt ID: P46098
• Protein name: 5-hydroxytryptamine receptor 3A (5-HT3-A) (5-HT3A) (5-hydroxytryptamine receptor 3) (5-HT-3) (5-HT3R) (Serotonin receptor 3A) (Serotonin-gated ion channel receptor)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,
• PDB: 8AXD, 8BL8, 8BLA, 8BLB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	35 → 242	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	249 → 469	Neurotransmitter-gated ion-channel transmembrane region	Family

• Sequence:

  MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
  VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
  LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
  TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
  RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
  GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
  STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
  ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA

• Sequence length: 478

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	19184136
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20356718, 21184810

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		22832903, 11505217
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	20694966, 22014438, 21937687, 19741568, 20728877, 20728877, 21937687, 19741568, 22014438, 16487942, 21937687
Mood disorder	Mood Disorders		16487942, 20694966