HTR1B (5-hydroxytryptamine receptor 1B)

Gene

• Entrez ID: 3351
• Gene name: 5-hydroxytryptamine receptor 1B
• Gene symbol: HTR1B
• Synonyms: 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
• Chromosome: 6
• Chromosome location: 6q14.1
• Summary: The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002447	hsa-miR-96-5p	Reporter assay	18283276

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA	21873635
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	1315531
GO:0005515	Function	Protein binding	IPI	24722188, 25416956, 25910212, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IMP	1315531
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	8882600
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA	21873635
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	1315531
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0008144	Function	Drug binding	IEA
GO:0014053	Process	Negative regulation of gamma-aminobutyric acid secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014063	Process	Negative regulation of serotonin secretion	ISS
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0035690	Process	Cellular response to drug	IDA	1315531
GO:0042220	Process	Response to cocaine	IEA
GO:0042310	Process	Vasoconstriction	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0051378	Function	Serotonin binding	IBA	21873635
GO:0051385	Process	Response to mineralocorticoid	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0071312	Process	Cellular response to alkaloid	IDA	1315531
GO:0071502	Process	Cellular response to temperature stimulus	IEA
GO:0098666	Component	G protein-coupled serotonin receptor complex	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099154	Component	Serotonergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099626	Function	Voltage-gated calcium channel activity involved in regulation of presynaptic cytosolic calcium levels	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	25871906
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

Other IDs

• MIM: 182131
• HGNC: 5287
• e!Ensembl: ENSG00000135312

Protein

• UniProt ID: P28222
• Protein name: 5-hydroxytryptamine receptor 1B (5-HT-1B) (5-HT1B) (S12) (Serotonin 1D beta receptor) (5-HT-1D-beta) (Serotonin receptor 1B)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:10452531, PubMed:1315531, PubMed:1328844, PubMed:1348246, PubMed:1351684, PubMed:1559993, PubMed:1565658, PubMed:1610347, PubMed:23519210, PubMed:23519215, PubMed:29925951, P
• PDB: 4IAQ, 4IAR, 5V54, 6G79, 7C61
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 369	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
  LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
  VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
  SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
  KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
  KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
  NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

• Sequence length: 390

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction

Reactome:

Serotonin receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	19038234
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	2533336

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		12496953, 14744462
Clonic seizures	Clonic Seizures		2533336
Hypotonic seizures	Epileptic drop attack		2533336
Jacksonian seizure	Jacksonian Seizure		2533336
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	23032875, 23269207, 21937687, 22040681, 22064162, 22040681, 21937687, 23032875, 22064162, 23269207, 15365222, 21937687, 20962330, 19702551, 19897250, 21937687, 20962330, 19897250, 15365222, 19702551
Mood disorder	Mood Disorders		14744462, 19702551, 20962330, 16461982
Psychosis	Psychosis, Brief Reactive, Psychotic Disorders		14708030
Schizoaffective disorder	Schizoaffective Disorder		14708030
Schizophreniform disorders	Schizophreniform Disorders		14708030