HSPA1L (heat shock protein family A (Hsp70) member 1 like)

Gene

• Entrez ID: 3305
• Gene name: Heat shock protein family A (Hsp70) member 1 like
• Gene symbol: HSPA1L
• Synonyms: HSP70-1L, HSP70-HOM, HSP70T, hum70t
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016961	hsa-miR-335-5p	Microarray	18185580
MIRT016961	hsa-miR-335-5p	Microarray	18185580
MIRT028894	hsa-miR-26b-5p	Microarray	19088304
MIRT028894	hsa-miR-26b-5p	Microarray	19088304
MIRT041506	hsa-miR-193b-3p	CLASH	23622248
MIRT2012888	hsa-miR-1237	CLIP-seq
MIRT2012889	hsa-miR-1248	CLIP-seq
MIRT2012890	hsa-miR-128	CLIP-seq
MIRT2012891	hsa-miR-27a	CLIP-seq
MIRT2012892	hsa-miR-27b	CLIP-seq
MIRT2012893	hsa-miR-3919	CLIP-seq
MIRT2012894	hsa-miR-3925-3p	CLIP-seq
MIRT2012895	hsa-miR-3925-5p	CLIP-seq
MIRT2012896	hsa-miR-4643	CLIP-seq
MIRT2012897	hsa-miR-4756-3p	CLIP-seq
MIRT2012898	hsa-miR-513a-5p	CLIP-seq
MIRT2012899	hsa-miR-515-5p	CLIP-seq
MIRT2012900	hsa-miR-766	CLIP-seq
MIRT2012893	hsa-miR-3919	CLIP-seq
MIRT2012895	hsa-miR-3925-5p	CLIP-seq
MIRT2012896	hsa-miR-4643	CLIP-seq
MIRT2012897	hsa-miR-4756-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0005515	Function	Protein binding	IPI	17184779, 25036637, 25241761, 25609649, 32296183
GO:0005524	Function	ATP binding	IBA	21873635
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	21231916
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006986	Process	Response to unfolded protein	TAS	9685725
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0008180	Component	COP9 signalosome	IBA	21873635
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0016192	Process	Vesicle-mediated transport	IBA	21873635
GO:0016887	Function	ATPase activity	IBA	21873635
GO:0031072	Function	Heat shock protein binding	IBA	21873635
GO:0031072	Function	Heat shock protein binding	IPI	17182002
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24270810
GO:0034620	Process	Cellular response to unfolded protein	IBA	21873635
GO:0042026	Process	Protein refolding	IBA	21873635
GO:0042026	Process	Protein refolding	IDA	21231916
GO:0044183	Function	Protein folding chaperone	IBA	21873635
GO:0044297	Component	Cell body	IEA
GO:0051082	Function	Unfolded protein binding	IBA	21873635
GO:0051082	Function	Unfolded protein binding	IDA	21231916
GO:0051085	Process	Chaperone cofactor-dependent protein refolding	IBA	21873635
GO:0051787	Function	Misfolded protein binding	IBA	21873635
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24270810

Other IDs

• MIM: 140559
• HGNC: 5234
• e!Ensembl: ENSG00000204390

Protein

• UniProt ID: P34931
• Protein name: Heat shock 70 kDa protein 1-like (Heat shock 70 kDa protein 1L) (Heat shock 70 kDa protein 1-Hom) (HSP70-Hom) (Heat shock protein family A member 1L)
• Protein function: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation
• PDB: 3GDQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00012	HSP70	8 → 614	Hsp70 protein	Family

• Sequence:

  MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
  VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
  ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
  AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
  SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
  RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
  LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
  TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
  DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
  KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
  LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

• Sequence length: 641

Pathways

KEGG:

Spliceosome
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Endocytosis
Longevity regulating pathway - multiple species
Antigen processing and presentation
Estrogen signaling pathway
Prion disease
Legionellosis
Toxoplasmosis
Measles
Lipid and atherosclerosis

Reactome:

Regulation of HSF1-mediated heat shock response
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Attenuation phase
HSF1-dependent transactivation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	17632545
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	20598377
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	19503088, 17804836, 21156761
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19439993, 18299791, 15963589, 23893339

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Regional enteritis	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	28126021
Mental depression	Major depression, single episode, Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	17428599
Scleroderma	Systemic Scleroderma		20383147
Ulcerative colitis	Ulcerative Colitis		24837172