BIRC3 (baculoviral IAP repeat containing 3)

Gene

• Entrez ID: 330
• Gene name: Baculoviral IAP repeat containing 3
• Gene symbol: BIRC3
• Synonyms: AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
• Chromosome: 11
• Chromosome location: 11q22.2
• Summary: This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits ap

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000071	hsa-miR-34a-5p	Microarray, Northern blot	17540599
MIRT019771	hsa-miR-375	Microarray	20215506
MIRT027437	hsa-miR-98-5p	Microarray	19088304
MIRT821549	hsa-miR-1182	CLIP-seq
MIRT821550	hsa-miR-1207-5p	CLIP-seq
MIRT821551	hsa-miR-3714	CLIP-seq
MIRT821552	hsa-miR-4264	CLIP-seq
MIRT821553	hsa-miR-4477a	CLIP-seq
MIRT821554	hsa-miR-4484	CLIP-seq
MIRT821555	hsa-miR-4728-3p	CLIP-seq
MIRT821556	hsa-miR-4763-3p	CLIP-seq
MIRT821557	hsa-miR-4775	CLIP-seq
MIRT821558	hsa-miR-4797-3p	CLIP-seq
MIRT821559	hsa-miR-513a-3p	CLIP-seq
MIRT821560	hsa-miR-548an	CLIP-seq
MIRT821561	hsa-miR-548n	CLIP-seq
MIRT821562	hsa-miR-548t	CLIP-seq
MIRT821563	hsa-miR-561	CLIP-seq
MIRT821564	hsa-miR-590-3p	CLIP-seq
MIRT821565	hsa-miR-651	CLIP-seq
MIRT821566	hsa-miR-940	CLIP-seq
MIRT821567	hsa-miR-1297	CLIP-seq
MIRT821568	hsa-miR-26a	CLIP-seq
MIRT821569	hsa-miR-26b	CLIP-seq
MIRT821570	hsa-miR-3152-5p	CLIP-seq
MIRT821571	hsa-miR-3199	CLIP-seq
MIRT821572	hsa-miR-4269	CLIP-seq
MIRT821573	hsa-miR-4437	CLIP-seq
MIRT821574	hsa-miR-4438	CLIP-seq
MIRT821575	hsa-miR-4465	CLIP-seq
MIRT821576	hsa-miR-4753-3p	CLIP-seq
MIRT821577	hsa-miR-5095	CLIP-seq
MIRT821578	hsa-miR-661	CLIP-seq
MIRT821571	hsa-miR-3199	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DEK	Unknown	16829531
HDAC1	Activation	17000776
NFKB1	Activation	10733571;11297551;11880364;12010810;19343319
NFKB1	Repression	15231833;15723831;18566231
NFKB1	Unknown	10823821;15050749;17000776;17673602
REL	Activation	11880364
RELA	Activation	10733571;11297551;11880364;12010810;19343319
RELA	Repression	15231833;15723831;18566231
RELA	Unknown	10823821;15050749;17000776;17673602

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	10797013
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	16395405, 21931591
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	11907583, 16123224, 16282325, 16395405, 19690564, 20562859, 21849505, 21931591, 21988832, 22902369, 23524849, 25241761, 25260751
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15665297, 16123224
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	15665297, 16123224
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8548810
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016740	Function	Transferase activity	EXP	19008929
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA	21873635
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	21931591
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	TAS	20888210
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS	20651737
GO:0039535	Process	Regulation of RIG-I signaling pathway	TAS	20888210
GO:0042981	Process	Regulation of apoptotic process	IMP	21737330
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	TAS	8552191
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	TAS	20651737
GO:0045088	Process	Regulation of innate immune response	TAS	21447281
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	TAS	21447281
GO:0051726	Process	Regulation of cell cycle	IBA	21873635
GO:0060544	Process	Regulation of necroptotic process	IMP	21737330
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0060546	Process	Negative regulation of necroptotic process	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0070424	Process	Regulation of nucleotide-binding oligomerization domain containing signaling pathway	TAS	20888210
GO:2000116	Process	Regulation of cysteine-type endopeptidase activity	TAS	20651737

Other IDs

• MIM: 601721
• HGNC: 591
• e!Ensembl: ENSG00000023445

Protein

• UniProt ID: Q13489
• Protein name: Baculoviral IAP repeat-containing protein 3 (EC 2.3.2.27) (Apoptosis inhibitor 2) (API2) (Cellular inhibitor of apoptosis 2) (C-IAP2) (IAP homolog C) (Inhibitor of apoptosis protein 1) (hIAP-1) (hIAP1) (RING finger protein 49) (RING-type E3 ubiquitin tran
• Protein function: Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin
• PDB: 2UVL, 3EB5, 3EB6, 3M0A, 3M0D, 7NK0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00653	BIR	32 → 97	Inhibitor of Apoptosis domain	Domain
  PF00653	BIR	172 → 236	Inhibitor of Apoptosis domain	Domain
  PF00653	BIR	258 → 323	Inhibitor of Apoptosis domain	Domain
  PF00619	CARD	444 → 528	Caspase recruitment domain	Domain
  PF13920	zf-C3HC4_3	553 → 598		Domain

• Sequence:

  MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
  NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
  THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
  LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
  DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
  CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
  IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
  LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
  VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
  DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
  TFLS

• Sequence length: 604

Pathways

KEGG:

Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Hippo signaling pathway
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Salmonella infection
Toxoplasmosis
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer

Reactome:

NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR2 non-canonical NF-kB pathway
Regulation of necroptotic cell death
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ub-specific processing proteases
IKK complex recruitment mediated by RIP1

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Leukemia	leukemia	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	12970779
Mucosa-associated lymphoma	Mucosa-Associated Lymphoid Tissue Lymphoma	rs387906350, rs587776630, rs587776631
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962, rs751524927, rs1575079076, rs1575446356, rs1478603808, rs1578264146, rs1578673280, rs1579484570, rs1579491104, rs1171390403, rs1582867955, rs764264135, rs951047896, rs890521687, rs1581495906, rs1587941402, rs1003155450, rs1588299621, rs1591100766, rs1591693095, rs1029296641, rs1593107841, rs1208575764, rs1593835248, rs1594406727, rs1594966387, rs1595889508, rs1159294530, rs1597073318, rs1135402871, rs1599413207, rs1418268495, rs1212577459, rs1600394490, rs1455074519, rs1603113792, rs1603415028, rs1602247047, rs1603452612

Unknown
Disease name	Disease term	dbSNP ID	References
B-cell lymphoma	B-Cell Lymphomas
Urinary bladder cancer	Malignant neoplasm of urinary bladder		12926068
Bladder neoplasm	Bladder Neoplasm		12926068
Fatty liver	Fatty Liver, Steatohepatitis		21664615
Lymphocytic leukemia	Chronic Lymphocytic Leukemia
Malignant lymphoma, lymphocytic, intermediate differentiation	Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse
Malt lymphoma	MALT lymphoma
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy
Uveitis	Uveitis, Posterior