GediPNet logo

HOXD13 (homeobox D13)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3239
Gene nameGene Name - the full gene name approved by the HGNC.
Homeobox D13
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HOXD13
SynonymsGene synonyms aliases
BDE, BDSD, HOX4I, SPD, SPD1
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28928891 A>C,G Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs28928892 C>A,G Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs28933082 C>G,T Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs104893635 A>G Pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
rs121912541 G>A,C,T Pathogenic Intron variant, missense variant, coding sequence variant, genic downstream transcript variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027146 hsa-miR-103a-3p Sequencing 20371350
MIRT051222 hsa-miR-16-5p CLASH 23622248
MIRT047651 hsa-miR-10a-5p CLASH 23622248
MIRT045586 hsa-miR-149-5p CLASH 23622248
MIRT042641 hsa-miR-423-3p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IMP 24789103
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P35453
Protein name Homeobox protein Hox-D13 (Homeobox protein Hox-4I)
Protein function Sequence-specific transcription factor that binds gene promoters and activates their transcription (PubMed:24789103). Part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12284 HoxA13_N
79 181
Hox protein A13 N terminal
Family
PF00046 Homeodomain
277 333
Homeodomain
Domain
Sequence
MSRAGSWDMDGLRADGGGAGGAPASSSSSSVAAAAASGQCRGFLSAPVFAGTHSGRAAAA
AAAAAAAAAAASGFAYPGTSERTGSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP
SAPALGYGYHFGNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYMDVSGLASSSVPA
N
EVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNS
QVYCTKDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKF
INKDKRRRISAATNLSERQVTIWFQNRRVKDKK
IVSKLKDTVS
Sequence length 343
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505 27725143
Anencephaly Anencephaly rs773607884
Brachydactyly BRACHYDACTYLY, TYPE D, Brachydactyly, Brachydactyly syndrome type E, Brachydactyly type E, NON RARE IN EUROPE: Brachydactyly type D rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852, rs121917853, rs121917854, rs121917855, rs121917859, rs121917861, rs267606873, rs267606872, rs267606985, rs267606986, rs267606987, rs267606988, rs28933082, rs397514519, rs869025613, rs869025614, rs886039878, rs1553540620, rs1057518333, rs1948841937, rs1948868228, rs1948842030, rs1948842142 24239177, 12649808, 17236141, 12649808
Brachydactyly-syndactyly syndrome BRACHYDACTYLY-SYNDACTYLY SYNDROME, Brachydactyly-syndactyly, Zhao type rs878854346, rs200750564 24239177, 23995701, 17236141, 12649808
Unknown
Disease name Disease term dbSNP ID References
Abnormal spinal segmentation Defect of vertebral segmentation
Ambiguous genitalia Ambiguous Genitalia rs782562963
Camptodactyly of fingers Clinodactyly of the 5th finger
Carpal synostosis Carpal synostosis

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412