Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
3198 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Homeobox A1 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
HOXA1 |
SynonymsGene synonyms aliases
|
BSAS, HOX1, HOX1F |
ChromosomeChromosome number
|
7 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
7p15.2 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo |
miRNAmiRNA information provided by mirtarbase database.
|
miRTarBase ID |
miRNA |
Experiments |
Reference |
MIRT001140 |
hsa-miR-10a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
16549775 |
MIRT000152 |
hsa-miR-210-3p |
Luciferase reporter assay |
19782034 |
MIRT001140 |
hsa-miR-10a-5p |
Review |
20029422 |
MIRT004641 |
hsa-miR-10b-5p |
Review |
20029422 |
MIRT001140 |
hsa-miR-10a-5p |
Reporter assay;Other |
16549775 |
MIRT001140 |
hsa-miR-10a-5p |
qRT-PCR, Western blot |
24498243 |
MIRT054544 |
hsa-miR-100-5p |
Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot |
24559685 |
MIRT054544 |
hsa-miR-100-5p |
Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot |
24559685 |
MIRT054544 |
hsa-miR-100-5p |
ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot |
24586203 |
MIRT054544 |
hsa-miR-100-5p |
ChIP-seq, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot |
24586203 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, Microarray, qRT-PCR, Western blot |
24312487 |
MIRT529277 |
hsa-miR-8080 |
PAR-CLIP |
22012620 |
MIRT529276 |
hsa-miR-6830-5p |
PAR-CLIP |
22012620 |
MIRT529275 |
hsa-miR-561-5p |
PAR-CLIP |
22012620 |
MIRT529274 |
hsa-miR-498 |
PAR-CLIP |
22012620 |
MIRT443420 |
hsa-miR-455-5p |
PAR-CLIP |
22100165 |
MIRT443419 |
hsa-miR-8060 |
PAR-CLIP |
22100165 |
MIRT443418 |
hsa-miR-6887-3p |
PAR-CLIP |
22100165 |
MIRT443417 |
hsa-miR-6795-3p |
PAR-CLIP |
22100165 |
MIRT443416 |
hsa-miR-203a-3p |
PAR-CLIP |
22100165 |
MIRT443415 |
hsa-miR-5189-3p |
PAR-CLIP |
22100165 |
MIRT443413 |
hsa-miR-1227-3p |
PAR-CLIP |
22100165 |
MIRT443414 |
hsa-miR-7154-5p |
PAR-CLIP |
22100165 |
MIRT443412 |
hsa-miR-6826-3p |
PAR-CLIP |
22100165 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
28228659 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
28228659 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
28228659 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
26417931 |
MIRT054708 |
hsa-miR-99a-5p |
Luciferase reporter assay, qRT-PCR, Western blot |
26417931 |
MIRT054544 |
hsa-miR-100-5p |
Luciferase reporter assay, Western blotting, qRT-PCR |
32364673 |
MIRT737404 |
hsa-miR-100-3p |
Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR |
32021301 |
MIRT529277 |
hsa-miR-8080 |
PAR-CLIP |
22012620 |
MIRT529276 |
hsa-miR-6830-5p |
PAR-CLIP |
22012620 |
MIRT529275 |
hsa-miR-561-5p |
PAR-CLIP |
22012620 |
MIRT529274 |
hsa-miR-498 |
PAR-CLIP |
22012620 |
MIRT443420 |
hsa-miR-455-5p |
PAR-CLIP |
22100165 |
MIRT443419 |
hsa-miR-8060 |
PAR-CLIP |
22100165 |
MIRT443418 |
hsa-miR-6887-3p |
PAR-CLIP |
22100165 |
MIRT443417 |
hsa-miR-6795-3p |
PAR-CLIP |
22100165 |
MIRT443416 |
hsa-miR-203a-3p |
PAR-CLIP |
22100165 |
MIRT443415 |
hsa-miR-5189-3p |
PAR-CLIP |
22100165 |
MIRT443413 |
hsa-miR-1227-3p |
PAR-CLIP |
22100165 |
MIRT443414 |
hsa-miR-7154-5p |
PAR-CLIP |
22100165 |
MIRT443412 |
hsa-miR-6826-3p |
PAR-CLIP |
22100165 |
MIRT1053119 |
hsa-miR-100 |
CLIP-seq |
|
MIRT1053120 |
hsa-miR-3119 |
CLIP-seq |
|
MIRT1053121 |
hsa-miR-3140-3p |
CLIP-seq |
|
MIRT1053122 |
hsa-miR-3179 |
CLIP-seq |
|
MIRT1053123 |
hsa-miR-3667-5p |
CLIP-seq |
|
MIRT1053124 |
hsa-miR-4652-3p |
CLIP-seq |
|
MIRT1053125 |
hsa-miR-556-3p |
CLIP-seq |
|
MIRT1053126 |
hsa-miR-99a |
CLIP-seq |
|
MIRT1053127 |
hsa-miR-99b |
CLIP-seq |
|
MIRT2012090 |
hsa-miR-4686 |
CLIP-seq |
|
MIRT2012091 |
hsa-miR-513a-3p |
CLIP-seq |
|
MIRT2244351 |
hsa-miR-1257 |
CLIP-seq |
|
MIRT2244352 |
hsa-miR-4279 |
CLIP-seq |
|
MIRT2244353 |
hsa-miR-4452 |
CLIP-seq |
|
MIRT2244354 |
hsa-miR-4459 |
CLIP-seq |
|
MIRT2244355 |
hsa-miR-4677-3p |
CLIP-seq |
|
MIRT2244356 |
hsa-miR-4679 |
CLIP-seq |
|
MIRT2244357 |
hsa-miR-4722-5p |
CLIP-seq |
|
MIRT2244358 |
hsa-miR-4779 |
CLIP-seq |
|
MIRT2547257 |
hsa-miR-1225-5p |
CLIP-seq |
|
MIRT2547258 |
hsa-miR-1252 |
CLIP-seq |
|
MIRT2547259 |
hsa-miR-1253 |
CLIP-seq |
|
MIRT2547260 |
hsa-miR-1273d |
CLIP-seq |
|
MIRT2547261 |
hsa-miR-1538 |
CLIP-seq |
|
MIRT2547262 |
hsa-miR-200b |
CLIP-seq |
|
MIRT2547263 |
hsa-miR-200c |
CLIP-seq |
|
MIRT2547264 |
hsa-miR-218 |
CLIP-seq |
|
MIRT2547265 |
hsa-miR-2355-5p |
CLIP-seq |
|
MIRT2547266 |
hsa-miR-28-5p |
CLIP-seq |
|
MIRT2547267 |
hsa-miR-3132 |
CLIP-seq |
|
MIRT2547268 |
hsa-miR-3139 |
CLIP-seq |
|
MIRT2547269 |
hsa-miR-3159 |
CLIP-seq |
|
MIRT2547270 |
hsa-miR-3190 |
CLIP-seq |
|
MIRT2547271 |
hsa-miR-3202 |
CLIP-seq |
|
MIRT2547272 |
hsa-miR-3607-3p |
CLIP-seq |
|
MIRT2547273 |
hsa-miR-3688-3p |
CLIP-seq |
|
MIRT2547274 |
hsa-miR-369-3p |
CLIP-seq |
|
MIRT2547275 |
hsa-miR-3936 |
CLIP-seq |
|
MIRT2547276 |
hsa-miR-3978 |
CLIP-seq |
|
MIRT2547277 |
hsa-miR-4267 |
CLIP-seq |
|
MIRT2547278 |
hsa-miR-429 |
CLIP-seq |
|
MIRT2547279 |
hsa-miR-4311 |
CLIP-seq |
|
MIRT2547280 |
hsa-miR-4318 |
CLIP-seq |
|
MIRT2547281 |
hsa-miR-4427 |
CLIP-seq |
|
MIRT2547282 |
hsa-miR-4435 |
CLIP-seq |
|
MIRT2547283 |
hsa-miR-4451 |
CLIP-seq |
|
MIRT2547284 |
hsa-miR-4533 |
CLIP-seq |
|
MIRT2547285 |
hsa-miR-4662a-3p |
CLIP-seq |
|
MIRT2547286 |
hsa-miR-4680-3p |
CLIP-seq |
|
MIRT2547287 |
hsa-miR-4694-3p |
CLIP-seq |
|
MIRT2547288 |
hsa-miR-4719 |
CLIP-seq |
|
MIRT2547289 |
hsa-miR-4740-3p |
CLIP-seq |
|
MIRT2547290 |
hsa-miR-4745-3p |
CLIP-seq |
|
MIRT2547291 |
hsa-miR-522 |
CLIP-seq |
|
MIRT2547292 |
hsa-miR-555 |
CLIP-seq |
|
MIRT2547293 |
hsa-miR-590-3p |
CLIP-seq |
|
MIRT2547294 |
hsa-miR-636 |
CLIP-seq |
|
MIRT2547295 |
hsa-miR-656 |
CLIP-seq |
|
MIRT2547296 |
hsa-miR-663b |
CLIP-seq |
|
MIRT2547297 |
hsa-miR-665 |
CLIP-seq |
|
MIRT2547298 |
hsa-miR-708 |
CLIP-seq |
|
MIRT2682422 |
hsa-miR-1227 |
CLIP-seq |
|
MIRT2547258 |
hsa-miR-1252 |
CLIP-seq |
|
MIRT2682423 |
hsa-miR-1255a |
CLIP-seq |
|
MIRT2682424 |
hsa-miR-1255b |
CLIP-seq |
|
MIRT2682425 |
hsa-miR-181a |
CLIP-seq |
|
MIRT2682426 |
hsa-miR-181b |
CLIP-seq |
|
MIRT2682427 |
hsa-miR-181c |
CLIP-seq |
|
MIRT2682428 |
hsa-miR-181d |
CLIP-seq |
|
MIRT2682429 |
hsa-miR-198 |
CLIP-seq |
|
MIRT2682430 |
hsa-miR-23a |
CLIP-seq |
|
MIRT2682431 |
hsa-miR-23b |
CLIP-seq |
|
MIRT2682432 |
hsa-miR-23c |
CLIP-seq |
|
MIRT2682433 |
hsa-miR-3160-3p |
CLIP-seq |
|
MIRT2547270 |
hsa-miR-3190 |
CLIP-seq |
|
MIRT2547271 |
hsa-miR-3202 |
CLIP-seq |
|
MIRT2682434 |
hsa-miR-323-3p |
CLIP-seq |
|
MIRT2682435 |
hsa-miR-326 |
CLIP-seq |
|
MIRT2682436 |
hsa-miR-330-5p |
CLIP-seq |
|
MIRT2682437 |
hsa-miR-3647-3p |
CLIP-seq |
|
MIRT2682438 |
hsa-miR-3663-5p |
CLIP-seq |
|
MIRT2682439 |
hsa-miR-3691-3p |
CLIP-seq |
|
MIRT2682440 |
hsa-miR-4262 |
CLIP-seq |
|
MIRT2547277 |
hsa-miR-4267 |
CLIP-seq |
|
MIRT2682441 |
hsa-miR-4289 |
CLIP-seq |
|
MIRT2547280 |
hsa-miR-4318 |
CLIP-seq |
|
MIRT2682442 |
hsa-miR-4487 |
CLIP-seq |
|
MIRT2682443 |
hsa-miR-4528 |
CLIP-seq |
|
MIRT2547284 |
hsa-miR-4533 |
CLIP-seq |
|
MIRT2547285 |
hsa-miR-4662a-3p |
CLIP-seq |
|
MIRT2682444 |
hsa-miR-4694-5p |
CLIP-seq |
|
MIRT2682445 |
hsa-miR-4782-5p |
CLIP-seq |
|
MIRT2682446 |
hsa-miR-493 |
CLIP-seq |
|
MIRT2682447 |
hsa-miR-558 |
CLIP-seq |
|
MIRT2682448 |
hsa-miR-593 |
CLIP-seq |
|
MIRT2682449 |
hsa-miR-664 |
CLIP-seq |
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
GO ID |
Ontology |
Definition |
Evidence |
Reference |
GO:0000785 |
Component |
Chromatin |
ISA |
|
GO:0000978 |
Function |
RNA polymerase II cis-regulatory region sequence-specific DNA binding |
IBA |
21873635 |
GO:0000981 |
Function |
DNA-binding transcription factor activity, RNA polymerase II-specific |
IBA |
21873635 |
GO:0000981 |
Function |
DNA-binding transcription factor activity, RNA polymerase II-specific |
ISA |
|
GO:0001228 |
Function |
DNA-binding transcription activator activity, RNA polymerase II-specific |
IDA |
15665309 |
GO:0005515 |
Function |
Protein binding |
IPI |
16189514, 18482256, 23088713, 23455924, 25416956, 25910212, 29892012, 30886144, 31515488, 32296183, 32814053 |
GO:0005634 |
Component |
Nucleus |
IBA |
21873635 |
GO:0006357 |
Process |
Regulation of transcription by RNA polymerase II |
IBA |
21873635 |
GO:0007275 |
Process |
Multicellular organism development |
TAS |
7622051 |
GO:0007605 |
Process |
Sensory perception of sound |
IDA |
16155570 |
GO:0007634 |
Process |
Optokinetic behavior |
IDA |
16155570 |
GO:0009653 |
Process |
Anatomical structure morphogenesis |
IMP |
16155570 |
GO:0021599 |
Process |
Abducens nerve formation |
IMP |
16155570 |
GO:0042473 |
Process |
Outer ear morphogenesis |
IDA |
16155570 |
GO:0042802 |
Function |
Identical protein binding |
IPI |
21516116, 25416956, 30886144, 32296183 |
GO:0043565 |
Function |
Sequence-specific DNA binding |
IDA |
23332764 |
GO:0045944 |
Process |
Positive regulation of transcription by RNA polymerase II |
IDA |
15665309 |
GO:0048702 |
Process |
Embryonic neurocranium morphogenesis |
IMP |
16155570 |
GO:0048839 |
Process |
Inner ear development |
IMP |
16155570 |
GO:0048844 |
Process |
Artery morphogenesis |
IMP |
16155570 |
GO:0050795 |
Process |
Regulation of behavior |
IDA |
16155570 |
GO:0050890 |
Process |
Cognition |
IDA |
16155570 |
GO:0050905 |
Process |
Neuromuscular process |
IDA |
16155570 |
GO:0060840 |
Process |
Artery development |
IMP |
16155570 |
GO:0060876 |
Process |
Semicircular canal formation |
IMP |
16155570 |
GO:0090102 |
Process |
Cochlea development |
IMP |
16155570 |
GO:0090103 |
Process |
Cochlea morphogenesis |
IMP |
16155570 |
GO:1990837 |
Function |
Sequence-specific double-stranded DNA binding |
IDA |
28473536 |
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P49639 |
Protein name |
Homeobox protein Hox-A1 (Homeobox protein Hox-1F) |
Protein function |
Sequence-specific transcription factor (By similarity). Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior (PubMe |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF00046 |
Homeodomain |
230 → 286 |
Homeodomain |
Domain |
|
Sequence |
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
|
|
Sequence length |
335 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Anencephaly |
Cranioschisis |
rs773607884 |
10529420 |
Autism |
Autistic Disorder |
rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634 |
11091361 |
Bosley-salih-alorainy syndrome |
Bosley-Salih-Alorainy Syndrome |
rs769152039, rs104894017, rs1562700083 |
24239177, 17875913 |
Congenital heart defects |
Congenital Heart Defects |
rs267607101, rs121434422, rs387906498, rs397509416, rs587777371, rs587777372, rs587777374, rs367537998, rs797044882, rs886041730, rs768027510, rs1064793873, rs1555447012, rs1554263268, rs1554263321, rs1555223294, rs782051102, rs1555896779, rs1555896778, rs1555897088, rs374016704, rs1555446983, rs1479104927, rs1562443558, rs755445139, rs1581616817, rs1581655293, rs1899172049 |
21940751 |
Developmental delay |
Gross motor development delay |
rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074 |
|
Hearing loss |
Sensorineural Hearing Loss (disorder) |
rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359, rs180177151, rs180177154, rs180177153, rs35689081, rs35887622, rs80338944, rs104894396, rs104894398, rs80338947, rs80338948, rs80338942, rs104894402, rs104894403, rs80338945, rs28931594, rs80338940, rs80338941, rs80356590, rs80338950, rs387906706, rs387906707, rs387906708, rs398122848, rs387907016, rs587776894, rs387907088, rs397515411, rs370965183, rs398122930, rs199897298, rs111033187, rs111033448, rs199606180, rs111033284, rs397516413, rs111033305, rs111033220, rs111033256, rs111033297, rs111033253, rs104894408, rs111033295, rs397516874, rs76434661, rs111033335, rs397517323, rs111033247, rs367928692, rs374793617, rs143939430, rs397515605, rs80338939, rs200656442, rs779748859, rs587781261, rs587781262, rs143343083, rs200147906, rs730880338, rs797044491, rs146281367, rs756484720, rs869025593, rs201306709, rs540895576, rs777777359, rs879255246, rs1554358720, rs142498437, rs377145777, rs1057517519, rs779077039, rs952741388, rs1060499797, rs764139009, rs1060499590, rs1064794012, rs1064797115, rs756790858, rs775633137, rs1554952443, rs1554952193, rs782063761, rs1199012623, rs756147087, rs1555648043, rs1555661490, rs1553196233, rs781546107, rs111033190, rs775428246, rs782539587, rs537227442, rs148695069, rs1554835827, rs953422571, rs1554834186, rs1554834161, rs1554835103, rs1554577339, rs1554577402, rs768471577, rs782279338, rs781951909, rs998045226, rs375759781, rs755804651, rs1557458426, rs767797828, rs538027448, rs1559366084, rs367688416, rs1558480402, rs1558490542, rs1559870857, rs1560690591, rs1561299289, rs1562817224, rs1562817529, rs1562822565, rs1562835391, rs1564113368, rs1564554255, rs773851192, rs1564555240, rs761261855, rs1564805114, rs1565522273, rs1565127413, rs781790246, rs1565430886, rs1565469959, rs746667217, rs1565819402, rs1565855932, rs150529554, rs1567939793, rs201866631, rs754472294, rs1559372512, rs1558464965, rs1558488902, rs775062249, rs1226171550, rs1561590396, rs765574676, rs762876554, rs757327146, rs1564949059, rs1565519673, rs368050948, rs1565541888, rs781989117, rs1565402473, rs750358148, rs1386887007, rs1209665716, rs1567641234, rs1237955948, rs1569042782, rs752672077, rs146689036, rs1560070780, rs149712664, rs1564556995, rs762226905, rs773573968, rs1568528171, rs1198256157, rs377267777, rs370564476, rs1577876794, rs747787770, rs759432278, rs1043716893, rs1581138934, rs2033773650, rs1421964916, rs771766431, rs780917129, rs1895773215, rs1895769400, rs761543680, rs1565920060 |
|
Human hoxa1 syndromes |
Athabaskan brainstem dysgenesis |
rs769152039, rs104894018 |
16155570, 24239177, 18412118, 12833395 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Athabaskan brainstem dysgenesis syndrome |
Athabaskan brainstem dysgenesis syndrome |
|
|
Drachtman weinblatt sitarz syndrome |
Congenital neurologic anomalies |
|
10529420 |
|
|
|