FOXA3 (forkhead box A3)

Gene

• Entrez ID: 3171
• Gene name: Forkhead box A3
• Gene symbol: FOXA3
• Synonyms: FKHH3, HNF3G, TCF3G
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017722	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IMP	9369482, 12695546, 18239190
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001678	Process	Cellular glucose homeostasis	TAS	9369482
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12695546
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9369482
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	TAS	7739897
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007275	Process	Multicellular organism development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008134	Function	Transcription factor binding	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA	21873635
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12695546
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 602295
• HGNC: 5023
• e!Ensembl: ENSG00000170608

Protein

• UniProt ID: P55318
• Protein name: Hepatocyte nuclear factor 3-gamma (HNF-3-gamma) (HNF-3G) (Fork head-related protein FKH H3) (Forkhead box protein A3) (Transcription factor 3G) (TCF-3G)
• Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC1 promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis.
• PDB: 1VTN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08430	Forkhead_N	16 → 116	Forkhead N-terminal region	Family
  PF00250	Forkhead	116 → 202	Forkhead domain	Domain

• Sequence:

  MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
  PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY
  SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR
  SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST
  TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
  NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

• Sequence length: 350

Pathways

KEGG:

Maturity onset diabetes of the young

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	22919386

Unknown
Disease name	Disease term	dbSNP ID	References
Prostatic neoplasms	Prostatic Neoplasms		22919386
Respiratory tract diseases	Respiratory Tract Diseases		30595370