GediPNet logo

FOXA2 (forkhead box A2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3170
Gene nameGene Name - the full gene name approved by the HGNC.
Forkhead box A2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
FOXA2
SynonymsGene synonyms aliases
HNF-3-beta, HNF3B, TCF3B
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p11.21
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family mem
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017120 hsa-miR-335-5p Microarray 18185580
MIRT017120 hsa-miR-335-5p Luciferase reporter assay, qRT-PCR, Western blot 24449834
MIRT017120 hsa-miR-335-5p Luciferase reporter assay, qRT-PCR, Western blot 24449834
MIRT440616 hsa-miR-1185-2-3p HITS-CLIP 24374217
MIRT440617 hsa-miR-1185-1-3p HITS-CLIP 24374217
Transcription factors
Transcription factor Regulation Reference
GLI2 Unknown 19360354
SMAD3 Unknown 21625455
USF1 Activation 22460558
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000432 Process Positive regulation of transcription from RNA polymerase II promoter by glucose ISS
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IMP 15737987
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12642491
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9Y261
Protein name Hepatocyte nuclear factor 3-beta (HNF-3-beta) (HNF-3B) (Forkhead box protein A2) (Transcription factor 3B) (TCF-3B)
Protein function Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin
PDB 5X07 , 7YZE , 7YZF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08430 Forkhead_N
16 158
Forkhead N-terminal region
Family
PF00250 Forkhead
158 244
Forkhead domain
Domain
PF09354 HNF_C
373 446
HNF3 C-terminal domain
Domain
Sequence
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTH
AKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFE
NGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG
TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP
EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG
SLAMGPVTNKTGLDASPLAADTSYYQ
GVYSRPIMNSS
Sequence length 457
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Longevity regulating pathway - multiple species
Maturity onset diabetes of the young
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Hyperinsulinemic hypoglycemia Congenital Hyperinsulinism rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402, rs980458021, rs375717077, rs786200932, rs587783169, rs72559713, rs72559716, rs786204542, rs541269678, rs570388861, rs72559722, rs786204676, rs151344624, rs797045637, rs797045212, rs797045211, rs797045207, rs797045213, rs761749884, rs863225280, rs139964066, rs886039877, rs886041392, rs886041391, rs746480424, rs1057516281, rs1057516317, rs576684889, rs764613146, rs773306994, rs1057516946, rs1057517139, rs1057516591, rs201682634, rs766891274, rs193922405, rs72559715, rs769518471, rs757171524, rs139328569, rs768951263, rs72559718, rs1260178539, rs200670692, rs72559734, rs1554910610, rs1554924035, rs372307320, rs1446306735, rs925231098, rs1554913069, rs1554923999, rs765090096, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1554949176, rs1411638309, rs1008906426, rs758844607, rs1554924540, rs755259997, rs769569410, rs72559730, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1398546361, rs781617345 29329447
Hyperinsulinism Hyperinsulinism rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209, rs761749884, rs797045624, rs863225280, rs139964066, rs1057516281, rs1057516317, rs576684889, rs201682634, rs1350717554, rs768951263, rs1260178539, rs200670692, rs72559734, rs1400535021, rs372307320, rs1554923999, rs751279984, rs1008906426, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1599937180 28973288
Pituitary hormone deficiency Combined pituitary hormone deficiencies, genetic forms rs104893754, rs104893756, rs104893757, rs104893759, rs104893760, rs104893761, rs104893762, rs587776798, rs104893758, rs104893763, rs104893764, rs104893765, rs587776799, rs104893766, rs370761964, rs515726221, rs606231411, rs772390221, rs754584667, rs777223697, rs777833871, rs1559614730
Unknown
Disease name Disease term dbSNP ID References
Hypopituitarism Hypopituitarism 28973288
Lung diseases Lung diseases 16863852

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412