GediPNet logo

HLF (HLF transcription factor, PAR bZIP family member)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3131
Gene nameGene Name - the full gene name approved by the HGNC.
HLF transcription factor, PAR bZIP family member
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
HLF
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q22
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT715185 hsa-miR-29a-5p HITS-CLIP 19536157
MIRT612902 hsa-miR-8485 HITS-CLIP 23313552
MIRT612901 hsa-miR-603 HITS-CLIP 23313552
MIRT702941 hsa-miR-374c-3p HITS-CLIP 23313552
MIRT612900 hsa-miR-600 HITS-CLIP 23313552
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 8065331
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q16534
Protein name Hepatic leukemia factor
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2
224 277
Basic region leucine zipper
Coiled-coil
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKE
LGKCKNILAKYEARHGPL
Sequence length 295
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Burkitt`s lymphoma Burkitt Lymphoma rs28933407, rs121918683, rs121918684 20519628
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor B-cell lymphoblastic leukemia, Precursor B-cell acute lymphoblastic leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 26214592, 20519628
Unknown
Disease name Disease term dbSNP ID References
Bipolar disorder Bipolar Disorder 31043756
Gout Gout 23263486
Gouty arthritis Arthritis, Gouty 23263486
Mental depression Unipolar Depression, Major Depressive Disorder rs587778876, rs587778877 25880836

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412